TFF3 Protein, Human, Recombinant (Yeast, His)

Catalog No. TMPY-04828U

TFF3 Protein, Human, Recombinant (Yeast, His) is expressed in P. pastoris (Yeast). The accession number is Q07654.

TFF3 Protein, Human, Recombinant (Yeast, His)

Catalog No. TMPY-04828U

TFF3 Protein, Human, Recombinant (Yeast, His) is expressed in P. pastoris (Yeast). The accession number is Q07654.

Pack Size	Price	USA Warehouse	Global Warehouse
5 μg	$70	20 days	20 days
10 μg	$109	20 days	20 days
20 μg	$182	20 days	20 days
50 μg	$357	20 days	20 days
100 μg	$590	20 days	20 days
200 μg	$987	20 days	20 days
500 μg	$1,980	20 days	20 days
1 mg	$3,520	20 days	20 days

Add to Cart

Add to Quotation

In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description	TFF3 Protein, Human, Recombinant (Yeast, His) is expressed in P. pastoris (Yeast). The accession number is Q07654.
Species	Human
Expression System	P. pastoris (Yeast)
Tag	N-6xHis
Accession Number	Q07654
Synonyms	trefoil factor 3 (intestinal),TFI,P1B,ITF
Amino Acid	LLSSSSAEEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGV
Construction	29-80 aa
Protein Purity	> 90% as determined by SDS-PAGE
Molecular Weight	7.5 kDa (Predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background	Involved in the maintenance and repair of the intestinal mucosa. Promotes the mobility of epithelial cells in healing processes (motogen).

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

trefoil factor 3 TMPY-04828 intestinal