TFF1 Protein, Human, Recombinant (His)

Name: TFF1 Protein, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPY-05431
Price: 71 USD
Availability: InStock
Rating: 5 (10 reviews)

(Synonyms: trefoil factor 1, pS2, pNR-2, HPS2, HP1.A, D21S21, BCEI) Copy Product Info

Synonyms: trefoil factor 1, pS2, pNR-2, HPS2, HP1.A, D21S21, BCEI

Catalog No. TMPY-05431 Copy Product Info

TFF1 Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 8.1 kDa and the accession number is P04155.

Pack Size	Price	USA Stock	Global Stock
5 µg	$71	-	In Stock
10 µg	$113	-	In Stock
20 µg	$187	7-10 days	7-10 days
50 µg	$368	7-10 days	7-10 days
100 µg	$618	-	In Stock

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:> 95 % as determined by SDS-PAGE.

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity testing is in progress. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	TFF1 Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 8.1 kDa and the accession number is P04155.
Species	Human
Expression System	HEK293 Cells
Tag	C-His
Accession Number	P04155
Amino Acid	EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEFAHHHHHHHHHH
Construction	A DNA sequence encoding the human TFF1 (NP_003216.1) (Met1-Phe84) was expressed with a polyhistidine tag at the C-terminus. Predicted N terminal: Glu 25
Protein Purity	> 95 % as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from a solution filtered through a 0.22 μm filter, containing PBS, pH 7.4. Typically, a mixture containing 5% to 8% trehalose, mannitol, and 0.01% Tween 80 is incorporated as a protective agent before lyophilization.
Reconstitution	Reconstituted with sterile deionized water to 0.25 mg/mL. Reconstitution conditions may vary depending on the lot.
Synonyms	trefoil factor 1, pS2, pNR-2, HPS2, HP1.A, D21S21, BCEI

Chemical Properties

Molecular Weight

8.1 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	It is recommended to store recombinant proteins at -20°C to -80°C for future use. Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.