Shopping Cart
Remove All
Your shopping cart is currently empty
Synonyms: trefoil factor 1, pS2, pNR-2, HPS2, HP1.A, D21S21, BCEI

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $71 | - | In Stock | |
| 10 μg | $113 | - | In Stock | |
| 20 μg | $187 | 7-10 days | 7-10 days | |
| 50 μg | $368 | 7-10 days | 7-10 days | |
| 100 μg | $618 | - | In Stock |
| Description | TFF1 Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 8.1 kDa and the accession number is P04155. |
| Species | Human |
| Expression System | HEK293 Cells |
| Tag | C-His |
| Accession Number | P04155 |
| Amino Acid | EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEFAHHHHHHHHHH |
| Construction | A DNA sequence encoding the human TFF1 (NP_003216.1) (Met1-Phe84) was expressed with a polyhistidine tag at the C-terminus. Predicted N terminal: Glu 25 |
| Protein Purity | > 95 % as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from a solution filtered through a 0.22 μm filter, containing PBS, pH 7.4. Typically, a mixture containing 5% to 8% trehalose, mannitol, and 0.01% Tween 80 is incorporated as a protective agent before lyophilization. |
| Reconstitution | Reconstituted with sterile deionized water to 0.25 mg/mL. Reconstitution conditions may vary depending on the lot. |
| Stability & Storage | It is recommended to store recombinant proteins at -20°C to -80°C for future use. Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Synonyms | trefoil factor 1, pS2, pNR-2, HPS2, HP1.A, D21S21, BCEI |
| Molecular Weight | 8.1 kDa (predicted) |
| Storage | Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.