Shopping Cart
Remove All
Your shopping cart is currently empty
TFF1 Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 8.1 kDa and the accession number is P04155.

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 μg | $71 | - | In Stock | |
| 10 μg | $113 | - | In Stock | |
| 20 μg | $187 | 7-10 days | 7-10 days | |
| 50 μg | $368 | 7-10 days | 7-10 days | |
| 100 μg | $618 | - | In Stock |
| Biological Activity | Activity testing is in progress. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | TFF1 Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 8.1 kDa and the accession number is P04155. |
| Species | Human |
| Expression System | HEK293 Cells |
| Tag | C-His |
| Accession Number | P04155 |
| Synonyms | trefoil factor 1,pS2,pNR-2,HPS2,HP1.A,D21S21,BCEI |
| Amino Acid | EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEFAHHHHHHHHHH |
| Construction | A DNA sequence encoding the human TFF1 (NP_003216.1) (Met1-Phe84) was expressed with a polyhistidine tag at the C-terminus. Predicted N terminal: Glu 25 |
| Protein Purity | > 95 % as determined by SDS-PAGE. |
| Molecular Weight | 8.1 kDa (predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from a solution filtered through a 0.22 μm filter, containing PBS, pH 7.4. Typically, a mixture containing 5% to 8% trehalose, mannitol, and 0.01% Tween 80 is incorporated as a protective agent before lyophilization. |
| Reconstitution | Reconstituted with sterile deionized water to 0.25 mg/mL. Reconstitution conditions may vary depending on the lot. |
| Stability & Storage | It is recommended to store recombinant proteins at -20°C to -80°C for future use. Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.