Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

TFF1 Protein, Human, Recombinant (His)

Catalog No. TMPY-05431

TFF1 Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 8.1 kDa and the accession number is P04155.

TFF1 Protein, Human, Recombinant (His)

TFF1 Protein, Human, Recombinant (His)

Catalog No. TMPY-05431
TFF1 Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 8.1 kDa and the accession number is P04155.
Pack SizePriceAvailabilityQuantity
100 μg$618In Stock
Bulk & Custom
Add to Cart
Questions
View More
Select Batch
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity testing is in progress. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
TFF1 Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 8.1 kDa and the accession number is P04155.
Species
Human
Expression System
HEK293 Cells
TagC-His
Accession NumberP04155
Synonyms
trefoil factor 1,pS2,pNR-2,HPS2,HP1.A,D21S21,BCEI
Amino Acid
EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEFAHHHHHHHHHH
Construction
A DNA sequence encoding the human TFF1 (NP_003216.1) (Met1-Phe84) was expressed with a polyhistidine tag at the C-terminus. Predicted N terminal: Glu 25
Protein Purity
> 95 % as determined by SDS-PAGE.
Molecular Weight8.1 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a solution filtered through a 0.22 μm filter, containing PBS, pH 7.4. Typically, a mixture containing 5% to 8% trehalose, mannitol, and 0.01% Tween 80 is incorporated as a protective agent before lyophilization.
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
It is recommended to store recombinant proteins at -20°C to -80°C for future use. Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords