Tetraspanin-2/TSPAN2 Protein, Human, Recombinant

Name: Tetraspanin-2/TSPAN2 Protein, Human, Recombinant
Brand: TargetMol
SKU: TMPH-02191
Rating: 4.5 (1 reviews)

(Synonyms: Tspan-2, TSPAN2, Tetraspanin-2, Tetraspan NET-3) Copy Product Info

Synonyms: Tspan-2, TSPAN2, Tetraspanin-2, Tetraspan NET-3

Catalog No. TMPH-02191 Copy Product Info

May play a role in signalling in oligodendrocytes in the early stages of their terminal differentiation into myelin-forming glia and may also function in stabilizing the mature sheath. Tetraspanin-2/TSPAN2 Protein, Human, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 8.8 kDa and the accession number is O60636.

Tetraspanin-2/TSPAN2 Protein, Human, Recombinant

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$142	20 days	20 days
10 µg	$235	20 days	20 days
20 µg	$392	20 days	20 days
50 µg	$519	20 days	20 days
100 µg	$647	20 days	20 days
200 µg	$928	20 days	20 days
500 µg	$1,480	20 days	20 days
1 mg	$2,170	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	May play a role in signalling in oligodendrocytes in the early stages of their terminal differentiation into myelin-forming glia and may also function in stabilizing the mature sheath. Tetraspanin-2/TSPAN2 Protein, Human, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 8.8 kDa and the accession number is O60636.
Species	Human
Expression System	E. coli
Tag	Tag Free
Accession Number	O60636
Amino Acid	GKGVAIRHVQTMYEEAYNDYLKDRGKGNGTLITFHSTFQCCGKESSEQVQPTCPKELLGHKNCIDEIETIISVKLQL
Construction	112-188 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	Tspan-2, TSPAN2, Tetraspanin-2, Tetraspan NET-3
Research Background	May play a role in signalling in oligodendrocytes in the early stages of their terminal differentiation into myelin-forming glia and may also function in stabilizing the mature sheath.

Chemical Properties

Molecular Weight

8.8 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.