Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Tetraspanin-2/TSPAN2 Protein, Human, Recombinant

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-02191

May play a role in signalling in oligodendrocytes in the early stages of their terminal differentiation into myelin-forming glia and may also function in stabilizing the mature sheath. Tetraspanin-2/TSPAN2 Protein, Human, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 8.8 kDa and the accession number is O60636.

Tetraspanin-2/TSPAN2 Protein, Human, Recombinant

Tetraspanin-2/TSPAN2 Protein, Human, Recombinant

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-02191
May play a role in signalling in oligodendrocytes in the early stages of their terminal differentiation into myelin-forming glia and may also function in stabilizing the mature sheath. Tetraspanin-2/TSPAN2 Protein, Human, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 8.8 kDa and the accession number is O60636.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 μg$14220 days20 days
10 μg$23520 days20 days
20 μg$39220 days20 days
50 μg$51920 days20 days
100 μg$64720 days20 days
200 μg$92820 days20 days
500 μg$1,48020 days20 days
1 mg$2,17020 days20 days
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
May play a role in signalling in oligodendrocytes in the early stages of their terminal differentiation into myelin-forming glia and may also function in stabilizing the mature sheath. Tetraspanin-2/TSPAN2 Protein, Human, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 8.8 kDa and the accession number is O60636.
Species
Human
Expression System
E. coli
TagTag Free
Accession NumberO60636
Synonyms
Tspan-2,TSPAN2,Tetraspanin-2,Tetraspan NET-3
Amino Acid
GKGVAIRHVQTMYEEAYNDYLKDRGKGNGTLITFHSTFQCCGKESSEQVQPTCPKELLGHKNCIDEIETIISVKLQL
Construction
112-188 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight8.8 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
May play a role in signalling in oligodendrocytes in the early stages of their terminal differentiation into myelin-forming glia and may also function in stabilizing the mature sheath.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords