Shopping Cart
- Remove All
Your shopping cart is currently empty
May play a role in signalling in oligodendrocytes in the early stages of their terminal differentiation into myelin-forming glia and may also function in stabilizing the mature sheath. Tetraspanin-2/TSPAN2 Protein, Human, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 8.8 kDa and the accession number is O60636.

| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 5 μg | $142 | 20 days | |
| 10 μg | $235 | 20 days | |
| 20 μg | $392 | 20 days | |
| 50 μg | $519 | 20 days | |
| 100 μg | $647 | 20 days | |
| 200 μg | $928 | 20 days | |
| 500 μg | $1,480 | 20 days | |
| 1 mg | $2,170 | 20 days |
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | May play a role in signalling in oligodendrocytes in the early stages of their terminal differentiation into myelin-forming glia and may also function in stabilizing the mature sheath. Tetraspanin-2/TSPAN2 Protein, Human, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 8.8 kDa and the accession number is O60636. |
| Species | Human |
| Expression System | E. coli |
| Tag | Tag Free |
| Accession Number | O60636 |
| Synonyms | Tspan-2,TSPAN2,Tetraspanin-2,Tetraspan NET-3 |
| Amino Acid | GKGVAIRHVQTMYEEAYNDYLKDRGKGNGTLITFHSTFQCCGKESSEQVQPTCPKELLGHKNCIDEIETIISVKLQL |
| Construction | 112-188 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Molecular Weight | 8.8 kDa (predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
| Research Background | May play a role in signalling in oligodendrocytes in the early stages of their terminal differentiation into myelin-forming glia and may also function in stabilizing the mature sheath. |

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.