Shopping Cart
Remove All
Your shopping cart is currently empty
Synonyms: Syndecan-4, SYND4, SDC4, Ryudocan core protein, Amphiglycan


| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 µg | $147 | 7-10 days | 7-10 days | |
| 10 µg | $196 | 7-10 days | 7-10 days | |
| 20 µg | $275 | 7-10 days | 7-10 days | |
| 50 µg | $418 | 7-10 days | 7-10 days | |
| 100 µg | $583 | 7-10 days | 7-10 days | |
| 200 µg | $823 | 7-10 days | 7-10 days | |
| 500 µg | $1,280 | 7-10 days | 7-10 days |
| Bioactivity | Fully biologically active when compared to standard. The specific activity is determined by binding ability in a functional ELISA. Immobilized rHuSYND4 at 500 ng/ml (100 μl/well) can bind rHubFGF with a linear range of 0.1-10 ng/ml. |
| Description | Syndecan-4 Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is P31431. |
| Species | Human |
| Expression System | E. coli |
| Tag | Tag Free |
| Accession Number | P31431 |
| Amino Acid | ESIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVEESEDVSNKVSMSSTVQGSNIFERTE |
| Construction | 19-145 aa |
| Protein Purity | >95% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from a 0.2 µm filtered PBS, pH 7.4 |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Synonyms | Syndecan-4, SYND4, SDC4, Ryudocan core protein, Amphiglycan |
| Molecular Weight | 13.9 kDa (Predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.