Shopping Cart
Remove All
Your shopping cart is currently empty
Streptavidin Protein, S. avidinii, Recombinant (His)
Catalog No. TMPH-03601 Copy Product Info
The biological function of streptavidin is not known. Forms a strong non-covalent specific complex with biotin (one molecule of biotin per subunit of streptavidin). Streptavidin Protein, S. avidinii, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 18.5 kDa and the accession number is P22629.
Streptavidin Protein, S. avidinii, Recombinant (His)
Catalog No. TMPH-03601
Copy Product InfoThe biological function of streptavidin is not known. Forms a strong non-covalent specific complex with biotin (one molecule of biotin per subunit of streptavidin). Streptavidin Protein, S. avidinii, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 18.5 kDa and the accession number is P22629.
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $143 | 20 days | 20 days | |
| 10 μg | $238 | 20 days | 20 days | |
| 20 μg | $397 | 20 days | 20 days | |
| 50 μg | $597 | 20 days | 20 days | |
| 100 μg | $845 | 20 days | 20 days |
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Batch Information
Resource Download
Product Information
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | The biological function of streptavidin is not known. Forms a strong non-covalent specific complex with biotin (one molecule of biotin per subunit of streptavidin). Streptavidin Protein, S. avidinii, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 18.5 kDa and the accession number is P22629. |
| Species | Streptomyces avidinii |
| Expression System | P. pastoris (Yeast) |
| Tag | N-6xHis |
| Accession Number | P22629 |
| Synonyms | Streptavidin |
| Amino Acid | DPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ |
| Construction | 25-183 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Molecular Weight | 18.5 kDa (predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Research Background | The biological function of streptavidin is not known. Forms a strong non-covalent specific complex with biotin (one molecule of biotin per subunit of streptavidin). |
Dose Conversion
You can also refer to dose conversion for different animals. More
Calculator
Tech Support
Please read the User Guide of Recombinant Proteins for more specific information.
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.