Has an anti-hypocalcemic action on calcium and phosphate homeostasis. STC2 Protein, Mouse, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 30.1 kDa and the accession number is O88452.
Pack Size | Availability | Price/USD | Quantity |
---|---|---|---|
20 μg | 20 days | $ 515.00 | |
100 μg | 20 days | $ 833.00 | |
1 mg | 20 days | $ 2,450.00 |
Description | Has an anti-hypocalcemic action on calcium and phosphate homeostasis. STC2 Protein, Mouse, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 30.1 kDa and the accession number is O88452. |
Species | Mouse |
Expression System | E. coli |
Tag | Tag Free |
Accession Number | O88452 |
Amino Acid | TDSTNPPEGPQDRSSQQKGRLSLQNTAEIQHCLVNAGDVGCGVFECFENNSCEIQGLHGICMTFLHNAGKFDAQGKSFIKDALRCKAHALRHKFGCISRKCPAIREMVFQLQRECYLKHDLCSAAQENVGVIVEMIHFKDLLLHEPYVDLVNLLLTCGEDVKEAVTRSVQAQCEQSWGGLCSILSFCTSNIQRPPTAAPEHQPLADRAQLSRPHHRDTDHHLTANRGAKGERGSKSHPNAHARGRTGGQSAQGPSGSSEWEDEQSEYSDIRR |
Construction | 25-296 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 30.1 kDa (predicted) |
Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Stability & Storage |
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted protein solutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping |
In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | Has an anti-hypocalcemic action on calcium and phosphate homeostasis. |
bottom
Please read the User Guide of Recombinant Proteins for more specific information.
recombinant recombinant-proteins proteins protein