Home Tools
Log in
Cart

STC2 Protein, Mouse, Recombinant

Catalog No. TMPH-02911

Has an anti-hypocalcemic action on calcium and phosphate homeostasis. STC2 Protein, Mouse, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 30.1 kDa and the accession number is O88452.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
STC2 Protein, Mouse, Recombinant
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 515.00
100 μg 20 days $ 833.00
1 mg 20 days $ 2,450.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description Has an anti-hypocalcemic action on calcium and phosphate homeostasis. STC2 Protein, Mouse, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 30.1 kDa and the accession number is O88452.
Species Mouse
Expression System E. coli
Tag Tag Free
Accession Number O88452
Amino Acid TDSTNPPEGPQDRSSQQKGRLSLQNTAEIQHCLVNAGDVGCGVFECFENNSCEIQGLHGICMTFLHNAGKFDAQGKSFIKDALRCKAHALRHKFGCISRKCPAIREMVFQLQRECYLKHDLCSAAQENVGVIVEMIHFKDLLLHEPYVDLVNLLLTCGEDVKEAVTRSVQAQCEQSWGGLCSILSFCTSNIQRPPTAAPEHQPLADRAQLSRPHHRDTDHHLTANRGAKGERGSKSHPNAHARGRTGGQSAQGPSGSSEWEDEQSEYSDIRR
Construction 25-296 aa
Protein Purity > 90% as determined by SDS-PAGE.
Molecular Weight 30.1 kDa (predicted)
Formulation If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted protein solutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Shipping

In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Research Background Has an anti-hypocalcemic action on calcium and phosphate homeostasis.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

recombinant recombinant-proteins proteins protein

 

TargetMol