SSA1 Protein, S. cerevisiae, Recombinant (His & Myc)

Catalog No. TMPH-03446

May play a role in the transport of polypeptides both across the mitochondrial membranes and into the endoplasmic reticulum. A functional difference between SSA1 and SSA2 proteins is expected. SSA1 can participate in the ATP-dependent disassembly of clathrin-coated vesicles. SSA1 Protein, S. cerevisiae, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 28.3 kDa and the accession number is P10591.

SSA1 Protein, S. cerevisiae, Recombinant (His & Myc)

Catalog No. TMPH-03446

Pack Size	Price	USA Warehouse	Global Warehouse
5 μg	$105	20 days	20 days
10 μg	$169	20 days	20 days
20 μg	$283	20 days	20 days
50 μg	$428	20 days	20 days
100 μg	$590	20 days	20 days
200 μg	$913	20 days	20 days
500 μg	$1,620	20 days	20 days
1 mg	$2,530	20 days	20 days

Add to Cart

Add to Quotation

In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	May play a role in the transport of polypeptides both across the mitochondrial membranes and into the endoplasmic reticulum. A functional difference between SSA1 and SSA2 proteins is expected. SSA1 can participate in the ATP-dependent disassembly of clathrin-coated vesicles. SSA1 Protein, S. cerevisiae, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 28.3 kDa and the accession number is P10591.
Species	Saccharomyces cerevisiae
Expression System	E. coli
Tag	N-10xHis, C-Myc
Accession Number	P10591
Synonyms	SSA1,Heat shock protein YG100,Heat shock protein SSA1
Amino Acid	ERAKTKDNNLLGKFELSGIPPAPRGVPQIEVTFDVDSNGILNVSAVEKGTGKSNKITITNDKGRLSKEDIEKMVAEAEKFKEEDEKESQRIASKNQLESIAYSLKNTISEAGDKLEQADKDTVTKKAEETISWLDSNTTASKEEFDDKLKELQDIANPIMSKLYQAGGAPGGAAGGAPGGFPGGAPPAPEAEGPTVEEVD
Construction	443-642 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Molecular Weight	28.3 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background	May play a role in the transport of polypeptides both across the mitochondrial membranes and into the endoplasmic reticulum. A functional difference between SSA1 and SSA2 proteins is expected. SSA1 can participate in the ATP-dependent disassembly of clathrin-coated vesicles.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

SSA 1