Sprr2a1 Protein, Mouse, Recombinant (His)

Catalog No. TMPH-02909 Copy Product Info

Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane. Sprr2a1 Protein, Mouse, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 13.4 kDa and the accession number is Q9CQK8.

Sprr2a1 Protein, Mouse, Recombinant (His)

Catalog No. TMPH-02909

Copy Product Info

Sprr2a1 Protein, Mouse, Recombinant (His)

Pack Size	Price	USA Stock	Global Stock
5 μg	$129	20 days	20 days
10 μg	$216	20 days	20 days
20 μg	$360	20 days	20 days
50 μg	$543	20 days	20 days
100 μg	$745	20 days	20 days
200 μg	$1,070	20 days	20 days
500 μg	$1,730	20 days	20 days
1 mg	$2,530	20 days	20 days

Add to Cart

Add to Quotation

For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane. Sprr2a1 Protein, Mouse, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 13.4 kDa and the accession number is Q9CQK8.
Species	Mouse
Expression System	E. coli
Tag	N-6xHis
Accession Number	Q9CQK8
Synonyms	Sprr2a1,Sprr2a,Small proline-rich protein 2A1,small proline-rich protein 2A
Amino Acid	MSYYQQQCNQPCRPPPVCPPPKCPEPCPPQVWPGPCRPVMCFEPCLPSVWPGPCRPVVCYEQCPPQPWQSTCPPVQFPPCQQK
Construction	1-83 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Molecular Weight	13.4 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background	Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

Sprr2a 1