SPARC Protein, Human, Recombinant

Name: SPARC Protein, Human, Recombinant
Brand: TargetMol
SKU: TMPH-04133
Price: 92 USD
Availability: InStock
Rating: 5 (10 reviews)

(Synonyms: SPARC, Secreted protein acidic and rich in cysteine, Osteonectin (ON), ON, Basement-membrane protein 40 (BM-40)) Copy Product Info

Synonyms: SPARC, Secreted protein acidic and rich in cysteine, Osteonectin (ON), ON, Basement-membrane protein 40 (BM-40)

Catalog No. TMPH-04133 Copy Product Info

SPARC Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is P09486.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$92	-	In Stock
10 µg	$147	-	In Stock
20 µg	$223	-	In Stock
50 µg	$393	7-10 days	7-10 days
100 µg	$613	7-10 days	7-10 days
200 µg	$857	7-10 days	7-10 days
500 µg	$1,330	7-10 days	7-10 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:> 98 % by SDS-PAGE and HPLC analyses.

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Fully biologically active when compared to standard. The ED50 as determined by its ability to inhibit the cell growth of Mv1Lu mink lung epithelial cells is less than 3.0 µg/mL, corresponding to a specific activity of > 333 IU/mg.
Description	SPARC Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is P09486.
Species	Human
Expression System	E. coli
Tag	Tag Free
Accession Number	P09486
Amino Acid	APQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI
Construction	18-303 aa
Protein Purity	>98% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from a 0.2 µm filtered PBS, pH 7.4
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	SPARC, Secreted protein acidic and rich in cysteine, Osteonectin (ON), ON, Basement-membrane protein 40 (BM-40)

Chemical Properties

Molecular Weight

32.7 kDa (Predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.