Shopping Cart
Remove All
Your shopping cart is currently empty
SPARC Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is P09486.

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 μg | $92 | - | In Stock | |
| 10 μg | $147 | - | In Stock | |
| 20 μg | $223 | - | In Stock | |
| 50 μg | $393 | 7-10 days | 7-10 days | |
| 100 μg | $613 | 7-10 days | 7-10 days | |
| 200 μg | $857 | 7-10 days | 7-10 days | |
| 500 μg | $1,330 | 7-10 days | 7-10 days |
| Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by its ability to inhibit the cell growth of Mv1Lu mink lung epithelial cells is less than 3.0 µg/mL, corresponding to a specific activity of > 333 IU/mg. |
| Description | SPARC Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is P09486. |
| Species | Human |
| Expression System | E. coli |
| Tag | Tag Free |
| Accession Number | P09486 |
| Synonyms | SPARC,Secreted protein acidic and rich in cysteine,Osteonectin (ON),ON,Basement-membrane protein 40 (BM-40) |
| Amino Acid | APQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI |
| Construction | 18-303 aa |
| Protein Purity | >98% as determined by SDS-PAGE. |
| Molecular Weight | 32.7 kDa (Predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from a 0.2 µm filtered PBS, pH 7.4 |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.