Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

Snx32 Protein, Mouse, Recombinant

Catalog No. TMPH-04468

Snx32 Protein, Mouse, Recombinant is expressed in E. coli. The accession number is Q80ZJ7.

Snx32 Protein, Mouse, Recombinant

Snx32 Protein, Mouse, Recombinant

Catalog No. TMPH-04468
Snx32 Protein, Mouse, Recombinant is expressed in E. coli. The accession number is Q80ZJ7.
Pack SizePriceAvailabilityQuantity
20 μg$49020 days
100 μg$77220 days
1 mg$2,73020 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Snx32 Protein, Mouse, Recombinant is expressed in E. coli. The accession number is Q80ZJ7.
Species
Mouse
Expression System
E. coli
TagTag Free
Accession NumberQ80ZJ7
Synonyms
Sorting nexin-6B,Sorting nexin-32,Snx6b,Snx32
Amino Acid
MEEQHQEAGNESKPSSTSVDLQGDSPLQVEISDAVSERDKVKFTVQTKSGLPHFAQSEFSVVRQHEEFIWLHDTYVENEEYAGLIIPPAPPRPDFEASREKLQKLGEGNSSITREEFSKMKQELEAEYLAIFKKTVAMHEVFLQRLAAHPTLRRDHNFSVFLEYSQDLSVREKNRKEVLG
Construction
1-180 aa
Protein Purity
> 95% as determined by SDS-PAGE.
Molecular Weight20.8 kDa (Predicted)
EndotoxinNot tested.
FormulationLyophilized from PBS, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 105 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords