Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

SMT3 Protein, S. cerevisiae, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03462 Copy Product Info
Not known; suppressor of MIF2 mutations.

SMT3 Protein, S. cerevisiae, Recombinant (His)

Catalog No. TMPH-03462
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

Not known; suppressor of MIF2 mutations.

SMT3 Protein, S. cerevisiae, Recombinant (His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$14320 days20 days
10 μg$23820 days20 days
20 μg$39720 days20 days
50 μg$59720 days20 days
100 μg$84520 days20 days
200 μg$1,19020 days20 days
500 μg$1,95020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Not known; suppressor of MIF2 mutations.
Species
Saccharomyces cerevisiae
Expression System
P. pastoris (Yeast)
TagN-6xHis
Accession NumberQ12306
Synonyms
Ubiquitin-like protein SMT3,SMT3
Amino Acid
SDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG
Construction
2-98 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight13.1 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Not known; suppressor of MIF2 mutations.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords