SLC39A14 Protein, Human, Recombinant (hFc)

Name: SLC39A14 Protein, Human, Recombinant (hFc)
Brand: TargetMol
SKU: TMPH-04014
Rating: 4.5 (1 reviews)

(Synonyms: Zrt- and Irt-like protein 14 (ZIP-14), ZIP14, Solute carrier family 39 member 14, SLC39A14, Metal cation symporter ZIP14, LIV-1 subfamily of ZIP zinc transporter 4 (LZT-Hs4), KIAA0062) Copy Product Info

Synonyms: Zrt- and Irt-like protein 14 (ZIP-14), ZIP14, Solute carrier family 39 member 14, SLC39A14, Metal cation symporter ZIP14, LIV-1 subfamily of ZIP zinc transporter 4 (LZT-Hs4), KIAA0062

Catalog No. TMPH-04014 Copy Product Info

SLC39A14 Protein, Human, Recombinant (hFc) is expressed in HEK293 Cells with C-hFc. The accession number is Q15043.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 μg	$133	20 days	20 days
10 μg	$219	20 days	20 days
20 μg	$368	20 days	20 days
50 μg	$643	20 days	20 days
100 μg	$987	20 days	20 days
200 μg	$1,530	20 days	20 days
500 μg	$2,770	20 days	20 days
1 mg	$4,330	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description	SLC39A14 Protein, Human, Recombinant (hFc) is expressed in HEK293 Cells with C-hFc. The accession number is Q15043.
Species	Human
Expression System	HEK293 Cells
Tag	C-hFc
Accession Number	Q15043
Amino Acid	SSLGAPAISAASFLQDLIHRYGEGDSLTLQQLKALLNHLDVGVGRGNVTQHVQGHRNLSTCFSSGDLFTAHNFSEQSRIGSSELQEFCPTILQQLDSRACTSENQENEENEQTEEGRPSAVEVWGYG
Construction	31-157 aa
Protein Purity	>85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	Zrt- and Irt-like protein 14 (ZIP-14), ZIP14, Solute carrier family 39 member 14, SLC39A14, Metal cation symporter ZIP14, LIV-1 subfamily of ZIP zinc transporter 4 (LZT-Hs4), KIAA0062

Chemical Properties

Molecular Weight

42.7 kDa (Predicted)

Storage & Solubility Information

Storage

Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

ZIP-14ZIP 14SLC39A 14LZT-Hs4LZTHs4KIAA 0062

Related Tags: SLC39A14 Protein, Human, Recombinant (hFc) chemical structure | SLC39A14 Protein, Human, Recombinant (hFc) molecular weight