SLC25A15 Protein, Human, Recombinant (GST)

Name: SLC25A15 Protein, Human, Recombinant (GST)
Brand: TargetMol
SKU: TMPH-04605
Rating: 4.5 (1 reviews)

(Synonyms: Solute carrier family 25 member 15, SLC25A15, ORNT1, ORC1, Mitochondrial ornithine transporter 1) Copy Product Info

Synonyms: Solute carrier family 25 member 15, SLC25A15, ORNT1, ORC1, Mitochondrial ornithine transporter 1

Catalog No. TMPH-04605 Copy Product Info

SLC25A15 Protein, Human, Recombinant (GST) is expressed in E. coli. The accession number is Q9Y619.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$98	20 days	20 days
10 µg	$159	20 days	20 days
20 µg	$266	20 days	20 days
50 µg	$378	20 days	20 days
100 µg	$498	20 days	20 days
200 µg	$769	20 days	20 days
500 µg	$1,370	20 days	20 days
1 mg	$2,130	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	SLC25A15 Protein, Human, Recombinant (GST) is expressed in E. coli. The accession number is Q9Y619.
Species	Human
Expression System	E. coli
Tag	N-GST
Accession Number	Q9Y619
Amino Acid	MKSNPAIQAAIDLTAGAAGGTACVLTGQPFDTMKVKMQTFPDLYRGLTDCCLKTYSQVGFRGFYKGTSPALIANIAENSVLFMCYGFCQQVVRKVAGLDKQAKLSDLQNAAAGSFASAFAALVLCPTELVKCRLQTMYEMETSGKIAKSQNTVWSVIKSILRKDGPLGFYHGLSSTLLREVPGYFFFFGGYELSRSFFASGRSKDELGPVPLMLSGGVGGICLWLAVYPVDCIKSRIQVLSMSGKQAGFIRTFINVVKNEGITALYSGLKPTMIRAFPANGALFLAYEYSRKLMMNQLEAY
Construction	1-301 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	Not tested.
Formulation	Lyophilized from PBS, 6% Trehalose, pH 7.4
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Solute carrier family 25 member 15, SLC25A15, ORNT1, ORC1, Mitochondrial ornithine transporter 1

Chemical Properties

Molecular Weight

59.7 kDa (Predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 242 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.