SIRT5 Protein, Mouse, Recombinant (E. coli, His & Myc)

Name: SIRT5 Protein, Mouse, Recombinant (E. coli, His & Myc)
Brand: TargetMol
SKU: TMPH-02799
Rating: 4.5 (1 reviews)

(Synonyms: Sirt5, SIR2-like protein 5, Sir2l5, Regulatory protein SIR2 homolog 5, NAD-dependent protein deacylase sirtuin-5, mitochondrial, mitochondrial) Copy Product Info

Synonyms: Sirt5, SIR2-like protein 5, Sir2l5, Regulatory protein SIR2 homolog 5, NAD-dependent protein deacylase sirtuin-5, mitochondrial, mitochondrial

Catalog No. TMPH-02799 Copy Product Info

SIRT5 Protein, Mouse, Recombinant (E. coli, His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 37.6 kDa and the accession number is Q8K2C6.

Pack Size	Price	USA Stock	Global Stock
5 μg	$129	20 days	20 days
10 μg	$216	20 days	20 days
20 μg	$360	20 days	20 days
50 μg	$543	20 days	20 days
100 μg	$745	20 days	20 days
200 μg	$1,070	20 days	20 days
500 μg	$1,730	20 days	20 days
1 mg	$2,530	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	SIRT5 Protein, Mouse, Recombinant (E. coli, His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 37.6 kDa and the accession number is Q8K2C6.
Species	Mouse
Expression System	E. coli
Tag	N-10xHis, C-Myc
Accession Number	Q8K2C6
Amino Acid	SSNMADFRKCFANAKHIAIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPQAFARNPSQVWEFYHYRREVMRSKEPNPGHLAIAQCEARLRDQGRRVVVITQNIDELHRKAGTKNLLEIHGTLFKTRCTSCGTVAENYRSPICPALAGKGAPEPETQDARIPVDKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELALCDLCLVVGTSSVVYPAAMFAPQVASRGVPVAEFNMETTPATDRFRFHFPGPCGKTLPEALAPHETERTS
Construction	37–310 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	Sirt5, SIR2-like protein 5, Sir2l5, Regulatory protein SIR2 homolog 5, NAD-dependent protein deacylase sirtuin-5, mitochondrial, mitochondrial
Research Background

Chemical Properties

Molecular Weight

37.6 kDa (predicted)

Storage & Solubility Information

Storage

Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

Sirt 5SIR2-like protein5Sir2l 5

Related Tags: SIRT5 Protein, Mouse, Recombinant (E. coli, His & Myc) chemical structure | SIRT5 Protein, Mouse, Recombinant (E. coli, His & Myc) molecular weight