SIRT3 Protein, Human, Recombinant (His)

Catalog No. TMPH-04030

SIRT3 Protein, Human, Recombinant (His) is expressed in E. coli with C-6xHis. The accession number is Q9NTG7.

SIRT3 Protein, Human, Recombinant (His)

Catalog No. TMPH-04030

SIRT3 Protein, Human, Recombinant (His) is expressed in E. coli with C-6xHis. The accession number is Q9NTG7.

Pack Size	Price	Availability
5 μg	$89	20 days
10 μg	$143	20 days
20 μg	$237	20 days
50 μg	$339	20 days
100 μg	$446	20 days
200 μg	$688	20 days
500 μg	$1,230	20 days
1 mg	$1,920	20 days

Bulk & Custom

Add to Cart

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Select Batch

Resource Download

COA User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description	SIRT3 Protein, Human, Recombinant (His) is expressed in E. coli with C-6xHis. The accession number is Q9NTG7.
Species	Human
Expression System	E. coli
Tag	C-6xHis
Accession Number	Q9NTG7
Synonyms	SIRT3,SIR2-like protein 3,SIR2L3,Regulatory protein SIR2 homolog 3,NAD-dependent protein delactylase sirtuin-3,NAD-dependent protein deacetylase sirtuin-3, mitochondrial,mitochondrial,hSIRT3
Amino Acid	SDKGKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK
Construction	118-399 aa
Protein Purity	>95% as determined by SDS-PAGE.
Molecular Weight	32.3 kDa (Predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.