Shopping Cart

Remove All

Your shopping cart is currently empty

Proceed to checkout Continue shopping

SIRT3 Protein, Human, Recombinant (His)

Name: SIRT3 Protein, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPH-04030
Rating: 4.5 (1 reviews)

(Synonyms: SIRT3, SIR2-like protein 3, SIR2L3, Regulatory protein SIR2 homolog 3, NAD-dependent protein delactylase sirtuin-3, NAD-dependent protein deacetylase sirtuin-3, mitochondrial, mitochondrial, hSIRT3) Copy Product Info

Synonyms: SIRT3, SIR2-like protein 3, SIR2L3, Regulatory protein SIR2 homolog 3, NAD-dependent protein delactylase sirtuin-3, NAD-dependent protein deacetylase sirtuin-3, mitochondrial, mitochondrial, hSIRT3

Catalog No. TMPH-04030 Copy Product Info

Purity: 95%

SIRT3 Protein, Human, Recombinant (His) is expressed in E. coli with C-6xHis. The accession number is Q9NTG7.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 μg	$89	20 days	20 days
10 μg	$143	20 days	20 days
20 μg	$237	20 days	20 days
50 μg	$339	20 days	20 days
100 μg	$446	20 days	20 days
200 μg	$688	20 days	20 days
500 μg	$1,230	20 days	20 days
1 mg	$1,920	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:95%

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description	SIRT3 Protein, Human, Recombinant (His) is expressed in E. coli with C-6xHis. The accession number is Q9NTG7.
Species	Human
Expression System	E. coli
Tag	C-6xHis
Accession Number	Q9NTG7
Amino Acid	SDKGKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK
Construction	118-399 aa
Protein Purity	>95% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	SIRT3, SIR2-like protein 3, SIR2L3, Regulatory protein SIR2 homolog 3, NAD-dependent protein delactylase sirtuin-3, NAD-dependent protein deacetylase sirtuin-3, mitochondrial, mitochondrial, hSIRT3

Chemical Properties

Molecular Weight

32.3 kDa (Predicted)

Storage & Solubility Information

Storage

Store at low temperature Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

SIRT 3SIR2-like protein3SIR2L 3hSIRT 3

Related Tags: SIRT3 Protein, Human, Recombinant (His) chemical structure | SIRT3 Protein, Human, Recombinant (His) molecular weight