Simian immunodeficiency virus (SIV) (isolate PBj14/BCL-3) Vpx Protein (His & SUMO)

Name: Simian immunodeficiency virus (SIV) (isolate PBj14/BCL-3) Vpx Protein (His & SUMO)
Brand: TargetMol
SKU: TMPH-03509
Rating: 4.5 (1 reviews)

(Synonyms: X ORF protein, vpx, Viral protein X, Protein Vpx) Copy Product Info

Synonyms: X ORF protein, vpx, Viral protein X, Protein Vpx

Catalog No. TMPH-03509 Copy Product Info

Simian immunodeficiency virus (SIV) (isolate PBj14/BCL-3) Vpx Protein (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 28.9 kDa and the accession number is P19508.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$129	20 days	20 days
10 µg	$216	20 days	20 days
20 µg	$360	20 days	20 days
50 µg	$543	20 days	20 days
100 µg	$745	20 days	20 days
200 µg	$1,070	20 days	20 days
500 µg	$1,730	20 days	20 days
1 mg	$2,530	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Simian immunodeficiency virus (SIV) (isolate PBj14/BCL-3) Vpx Protein (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 28.9 kDa and the accession number is P19508.
Species	SIV
Expression System	E. coli
Tag	N-6xHis-SUMO
Accession Number	P19508
Amino Acid	MSDPRERIPPGNSGEETIGEAFDWLDRTVEEINRAAVNHLPRELIFQVWRRSWEYWHDEMGMSVSYTKYRYLCLIQKAMFMHCKKGCRCLGGEHGAGGWRPGPPPPPPPGLA
Construction	1-112 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	X ORF protein, vpx, Viral protein X, Protein Vpx
Research Background	Plays a role in nuclear translocation of the viral pre-integration complex (PIC), thus is required for the virus to infect non-dividing cells. Targets specific host proteins for degradation by the 26S proteasome. Acts by associating with the cellular CUL4A-DDB1 E3 ligase complex through direct interaction with host VPRPB/DCAF-1. This change in the E3 ligase substrate specificity results in the degradation of host SAMHD1. In turn, SAMHD1 depletion allows viral replication in host myeloid cells by preventing SAMHD1-mediated hydrolysis of intracellular dNTPs necessary for reverse transcription.

Chemical Properties

Molecular Weight

28.9 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Recombinant Proteins

Keywords

X-ORF proteinViral protein-X

Related Tags: Simian immunodeficiency virus (SIV) (isolate PBj14/BCL-3) Vpx Protein (His & SUMO) chemical structure | Simian immunodeficiency virus (SIV) (isolate PBj14/BCL-3) Vpx Protein (His & SUMO) molecular weight