SFTPA1 Protein, Human, Recombinant (B2M & His & Myc)

Name: SFTPA1 Protein, Human, Recombinant (B2M & His & Myc)
Brand: TargetMol
SKU: TMPH-01978
Rating: 4.5 (1 reviews)

(Synonyms: SP-A1, SP-A, SFTPA1B, SFTPA1, SFTPA, SFTP1, Pulmonary surfactant-associated protein A1, PSP-A, PSPA, PSAP, Collectin-4, COLEC4, Alveolar proteinosis protein, 35 kDa pulmonary surfactant-associated protein) Copy Product Info

Synonyms: SP-A1, SP-A, SFTPA1B, SFTPA1, SFTPA, SFTP1, Pulmonary surfactant-associated protein A1, PSP-A, PSPA, PSAP, Collectin-4, COLEC4, Alveolar proteinosis protein, 35 kDa pulmonary surfactant-associated protein

Catalog No. TMPH-01978 Copy Product Info

In presence of calcium ions, it binds to surfactant phospholipids and contributes to lower the surface tension at the air-liquid interface in the alveoli of the mammalian lung and is essential for normal respiration. Enhances the expression of MYO18A/SP-R210 on alveolar macrophages.; (Microbial infection) Recognition of M.tuberculosis by dendritic cells may occur partially via this molecule. Can recognize, bind, and opsonize pathogens to enhance their elimination by alveolar macrophages. SFTPA1 Protein, Human, Recombinant (B2M & His & Myc) is expressed in E. coli expression system with N-10xHis-B2M and C-Myc tag. The predicted molecular weight is 41.2 kDa and the accession number is Q8IWL2.

SFTPA1 Protein, Human, Recombinant (B2M & His & Myc)

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 μg	$276	20 days	20 days
10 μg	$463	20 days	20 days
20 μg	$780	20 days	20 days
50 μg	$987	20 days	20 days
100 μg	$1,260	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	In presence of calcium ions, it binds to surfactant phospholipids and contributes to lower the surface tension at the air-liquid interface in the alveoli of the mammalian lung and is essential for normal respiration. Enhances the expression of MYO18A/SP-R210 on alveolar macrophages.; (Microbial infection) Recognition of M.tuberculosis by dendritic cells may occur partially via this molecule. Can recognize, bind, and opsonize pathogens to enhance their elimination by alveolar macrophages. SFTPA1 Protein, Human, Recombinant (B2M & His & Myc) is expressed in E. coli expression system with N-10xHis-B2M and C-Myc tag. The predicted molecular weight is 41.2 kDa and the accession number is Q8IWL2.
Species	Human
Expression System	E. coli
Tag	N-10xHis-B2M, C-Myc
Accession Number	Q8IWL2
Amino Acid	EVKDVCVGSPGIPGTPGSHGLPGRDGRDGLKGDPGPPGPMGPPGEMPCPPGNDGLPGAPGIPGECGEKGEPGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF
Construction	21-248 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	SP-A1, SP-A, SFTPA1B, SFTPA1, SFTPA, SFTP1, Pulmonary surfactant-associated protein A1, PSP-A, PSPA, PSAP, Collectin-4, COLEC4, Alveolar proteinosis protein, 35 kDa pulmonary surfactant-associated protein
Research Background

Chemical Properties

Molecular Weight

41.2 kDa (predicted)

Storage & Solubility Information

Storage

Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

SP-A-1SFTPA 1SFTP 1Collectin4COLEC 4

Related Tags: SFTPA1 Protein, Human, Recombinant (B2M & His & Myc) chemical structure | SFTPA1 Protein, Human, Recombinant (B2M & His & Myc) molecular weight