Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Selenoprotein M/SELM Protein, Human, Recombinant

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-02073 Copy Product Info
Selenoprotein M/SELM Protein, Human, Recombinant is expressed in E. coli.

Selenoprotein M/SELM Protein, Human, Recombinant

Catalog No. TMPH-02073
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

Selenoprotein M/SELM Protein, Human, Recombinant is expressed in E. coli.

Selenoprotein M/SELM Protein, Human, Recombinant
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$14220 days20 days
10 μg$23520 days20 days
20 μg$39220 days20 days
50 μg$51920 days20 days
100 μg$64720 days20 days
200 μg$92820 days20 days
500 μg$1,48020 days20 days
1 mg$2,17020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Selenoprotein M/SELM Protein, Human, Recombinant is expressed in E. coli.
Species
Human
Expression System
E. coli
TagTag Free
Accession NumberQ8WWX9
Synonyms
SELM,Selenoprotein M,SELENOM
Amino Acid
ATAYRPDWNRLSGLTRARVETCGGSQLNRLKEVKAFVTQDIPFYHNLVMKHLPGADPELVLLGRRYEELERIPLSEMTREEINALVQELGFYRKAAPDAQVPPEYVWAPAKPPEETSDHADL
Construction
24-145 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight13.9 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
May function as a thiol-disulfide oxidoreductase that participates in disulfide bond formation.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.