SCIN Protein, S. aureus, Recombinant (His & Myc)

Name: SCIN Protein, S. aureus, Recombinant (His & Myc)
Brand: TargetMol
SKU: TMPH-03578
Rating: 4.5 (1 reviews)

(Synonyms: Staphylococcal complement inhibitor, scn, SCIN) Copy Product Info

Synonyms: Staphylococcal complement inhibitor, scn, SCIN

Catalog No. TMPH-03578 Copy Product Info

SCIN Protein, S. aureus, Recombinant (His & Myc) is expressed in E. coli. The accession number is A7X482.

Customer service consultation

Pack Size	Price	EUR Stock	Global Stock
5 µg	116 €	20 days	20 days
10 µg	194 €	20 days	20 days
20 µg	324 €	20 days	20 days
50 µg	488 €	20 days	20 days
100 µg	670 €	20 days	20 days
200 µg	963 €	20 days	20 days
500 µg	1.557 €	20 days	20 days
1 mg	2.277 €	20 days	20 days

For In stock only · Estimated delivery: EUR Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Information

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	SCIN Protein, S. aureus, Recombinant (His & Myc) is expressed in E. coli. The accession number is A7X482.
Species	Staphylococcus aureus
Expression System	E. coli
Tag	N-10xHis, C-Myc
Accession Number	A7X482
Amino Acid	STSLPTSNEYQNEKLANELKSLLDELNVNELATGSLNTYYKRTIKISGQKAMYALKSKDFKKMSEAKYQLQKIYNEIDEALKSKY
Construction	32-116 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Staphylococcal complement inhibitor, scn, SCIN
Research Background	Involved in countering the first line of host defense mechanisms. Efficiently inhibits opsonization, phagocytosis and killing of S.aureus by human neutrophils. Acts by binding and stabilizing human C3 convertases (C4b2a and C3bBb), leading to their inactivation. The convertases are no longer able to cleave complement C3, therefore preventing further C3b deposition on the bacterial surface and phagocytosis of the bacterium. Also prevents C5a-induced neutrophil responses.

Chemical Properties

Molecular Weight

17.2 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	It is recommended to store recombinant proteins at -20°C to -80°C for future use. Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Recombinant Proteins

Related Tags: SCIN Protein, S. aureus, Recombinant (His & Myc) chemical structure | SCIN Protein, S. aureus, Recombinant (His & Myc) molecular weight