Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

SCIMP Protein, Human, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-04129

SCIMP Protein, Human, Recombinant (His) is expressed in in vitro E. coli expression system with N-10xHis. The accession number is Q6UWF3.

SCIMP Protein, Human, Recombinant (His)

SCIMP Protein, Human, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-04129
SCIMP Protein, Human, Recombinant (His) is expressed in in vitro E. coli expression system with N-10xHis. The accession number is Q6UWF3.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 μg$51920 days20 days
10 μg$87520 days20 days
20 μg$1,48020 days20 days
50 μg$1,98020 days20 days
100 μg$2,48020 days20 days
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description
SCIMP Protein, Human, Recombinant (His) is expressed in in vitro E. coli expression system with N-10xHis. The accession number is Q6UWF3.
Species
Human
Expression System
in vitro E. coli expression system
TagN-10xHis
Accession NumberQ6UWF3
Synonyms
SLP65/SLP76, Csk-interacting membrane protein,SLP adapter and CSK-interacting membrane protein,SCIMP,C17orf87
Amino Acid
MDTFTVQDSTAMSWWRNNFWIILAVAIIVVSVGLGLILYCVCKWQLRRGKKWEIAKPLKHKQVDEEKMYENVLNESPVQLPPLPPRNWPSLEDSSPQEAPSQPPATYSLVNKVKNKKTVSIPSYIEPEDDYDDVEIPANTEKASF
Construction
1-145 aa
Protein Purity
>85% as determined by SDS-PAGE.
Molecular Weight22.7 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords