Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

SAA3 Protein, Mouse, Recombinant (E. coli, His)

Catalog No. TMPH-02901

Major acute phase reactant. Apolipoprotein of the HDL complex. SAA3 Protein, Mouse, Recombinant (E. coli, His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 15.8 kDa and the accession number is P04918.

SAA3 Protein, Mouse, Recombinant (E. coli, His)

SAA3 Protein, Mouse, Recombinant (E. coli, His)

Catalog No. TMPH-02901
Major acute phase reactant. Apolipoprotein of the HDL complex. SAA3 Protein, Mouse, Recombinant (E. coli, His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 15.8 kDa and the accession number is P04918.
Pack SizePriceAvailabilityQuantity
20 μg$41020 days
100 μg$85820 days
1 mgInquiry20 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More
Select Batch

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Major acute phase reactant. Apolipoprotein of the HDL complex. SAA3 Protein, Mouse, Recombinant (E. coli, His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 15.8 kDa and the accession number is P04918.
Species
Mouse
Expression System
E. coli
TagN-6xHis
Accession NumberP04918
Synonyms
Serum amyloid A-3 protein,Saa3
Amino Acid
RWVQFMKEAGQGSRDMWRAYSDMKKANWKNSDKYFHARGNYDAARRGPGGAWAAKVISDAREAVQKFTGHGAEDSRADQFANEWGRSGKDPNHFRPAGLPKRY
Construction
20-122 aa
Protein Purity
> 90% as determined by SDS-PAGE.
SAA3 Protein, Mouse, Recombinant (E. coli, His)
Molecular Weight15.8 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Major acute phase reactant. Apolipoprotein of the HDL complex.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords