Shopping Cart
Remove All
Your shopping cart is currently empty
RzoR Protein, E. coli, Recombinant (Flag & His)
(Synonyms: Spanin from lambdoid prophage Rac, outer membrane subunit, rzoR, Prophage outer membrane lipoprotein RzoR, Outer membrane lipoprotein Rz1 from lambdoid prophage Rac, o-spanin) Copy Product InfoSynonyms: Spanin from lambdoid prophage Rac, outer membrane subunit, rzoR, Prophage outer membrane lipoprotein RzoR, Outer membrane lipoprotein Rz1 from lambdoid prophage Rac, o-spanin
Catalog No. TMPH-00716 Copy Product Info
Component of the spanin complex that disrupts the outer membrane and causes cell lysis during virus exit. The spanin complex conducts the final step in cell lysis by disrupting the outer membrane after holin and endolysin action have permeabilized the inner membrane and degraded the host peptidoglycans.
Customer service consultation
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $129 | 20 days | 20 days | |
| 10 μg | $216 | 20 days | 20 days | |
| 20 μg | $360 | 20 days | 20 days | |
| 50 μg | $543 | 20 days | 20 days | |
| 100 μg | $745 | 20 days | 20 days | |
| 200 μg | $1,070 | 20 days | 20 days | |
| 500 μg | $1,730 | 20 days | 20 days | |
| 1 mg | $2,530 | 20 days | 20 days |
For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)
Add to Cart
Add to Quotation
For research use only—not for human use. No sales to individuals. Use as intended only.
Resource Download
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Description | Component of the spanin complex that disrupts the outer membrane and causes cell lysis during virus exit. The spanin complex conducts the final step in cell lysis by disrupting the outer membrane after holin and endolysin action have permeabilized the inner membrane and degraded the host peptidoglycans. |
| Species | E. coli |
| Expression System | E. coli |
| Tag | N-6xHis-Flag |
| Accession Number | P58042 |
| Amino Acid | CTSKQSVSQCVKPPPPPAWIMQPPPDWQTPLNGIISPSGNDW |
| Construction | 20-61 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Synonyms | Spanin from lambdoid prophage Rac, outer membrane subunit, rzoR, Prophage outer membrane lipoprotein RzoR, Outer membrane lipoprotein Rz1 from lambdoid prophage Rac, o-spanin |
| Research Background |
| Molecular Weight | 11.5 kDa (predicted) |
| Storage | Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months |
Calculator
Dose Conversion
You can also refer to dose conversion for different animals. More Dose Conversion
Tech Support
Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc
Preview
Related Tags: RzoR Protein, E. coli, Recombinant (Flag & His) chemical structure | RzoR Protein, E. coli, Recombinant (Flag & His) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.