Shopping Cart
Remove All
Your shopping cart is currently empty
Component of the spanin complex that disrupts the outer membrane and causes cell lysis during virus exit. The spanin complex conducts the final step in cell lysis by disrupting the outer membrane after holin and endolysin action have permeabilized the inner membrane and degraded the host peptidoglycans.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $129 | 20 days | 20 days | |
| 10 μg | $216 | 20 days | 20 days | |
| 20 μg | $360 | 20 days | 20 days | |
| 50 μg | $543 | 20 days | 20 days | |
| 100 μg | $745 | 20 days | 20 days | |
| 200 μg | $1,070 | 20 days | 20 days | |
| 500 μg | $1,730 | 20 days | 20 days | |
| 1 mg | $2,530 | 20 days | 20 days |
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Component of the spanin complex that disrupts the outer membrane and causes cell lysis during virus exit. The spanin complex conducts the final step in cell lysis by disrupting the outer membrane after holin and endolysin action have permeabilized the inner membrane and degraded the host peptidoglycans. |
| Species | E. coli |
| Expression System | E. coli |
| Tag | N-6xHis-Flag |
| Accession Number | P58042 |
| Synonyms | Spanin from lambdoid prophage Rac, outer membrane subunit,rzoR,Prophage outer membrane lipoprotein RzoR,Outer membrane lipoprotein Rz1 from lambdoid prophage Rac,o-spanin |
| Amino Acid | CTSKQSVSQCVKPPPPPAWIMQPPPDWQTPLNGIISPSGNDW |
| Construction | 20-61 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Molecular Weight | 11.5 kDa (predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Research Background | Component of the spanin complex that disrupts the outer membrane and causes cell lysis during virus exit. The spanin complex conducts the final step in cell lysis by disrupting the outer membrane after holin and endolysin action have permeabilized the inner membrane and degraded the host peptidoglycans. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.