Ribosomal protein uS5 Protein, S. aureus, Recombinant (His & Myc)

Name: Ribosomal protein uS5 Protein, S. aureus, Recombinant (His & Myc)
Brand: TargetMol
SKU: TMPH-03517
Rating: 4.5 (1 reviews)

(Synonyms: Small ribosomal subunit protein uS5, rpsE, 30S ribosomal protein S5) Copy Product Info

Synonyms: Small ribosomal subunit protein uS5, rpsE, 30S ribosomal protein S5

Catalog No. TMPH-03517 Copy Product Info

With S4 and S12 plays an important role in translational accuracy.; Located at the back of the 30S subunit body where it stabilizes the conformation of the head with respect to the body. Ribosomal protein uS5 Protein, S. aureus, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 24.8 kDa and the accession number is A6QJ75.

Ribosomal protein uS5 Protein, S. aureus, Recombinant (His & Myc)

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$129	20 days	20 days
10 µg	$216	20 days	20 days
20 µg	$360	20 days	20 days
50 µg	$543	20 days	20 days
100 µg	$745	20 days	20 days
200 µg	$1,070	20 days	20 days
500 µg	$1,730	20 days	20 days
1 mg	$2,530	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	With S4 and S12 plays an important role in translational accuracy.; Located at the back of the 30S subunit body where it stabilizes the conformation of the head with respect to the body. Ribosomal protein uS5 Protein, S. aureus, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 24.8 kDa and the accession number is A6QJ75.
Species	Staphylococcus aureus
Expression System	E. coli
Tag	N-10xHis, C-Myc
Accession Number	A6QJ75
Amino Acid	MARREEETKEFEERVVTINRVAKVVKGGRRFRFTALVVVGDKNGRVGFGTGKAQEVPEAIKKAVEAAKKDLVVVPRVEGTTPHTITGRYGSGSVFMKPAAPGTGVIAGGPVRAVLELAGITDILSKSLGSNTPINMVRATIDGLQNLKNAEDVAKLRGKTVEE
Construction	1-163 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Small ribosomal subunit protein uS5, rpsE, 30S ribosomal protein S5
Research Background	With S4 and S12 plays an important role in translational accuracy.; Located at the back of the 30S subunit body where it stabilizes the conformation of the head with respect to the body.

Chemical Properties

Molecular Weight

24.8 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Recombinant Proteins

Related Tags: Ribosomal protein uS5 Protein, S. aureus, Recombinant (His & Myc) chemical structure | Ribosomal protein uS5 Protein, S. aureus, Recombinant (His & Myc) molecular weight