Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Reticulocalbin-1/RCN1 Protein, Human, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-02030

Reticulocalbin-1/RCN1 Protein, Human, Recombinant (His) is expressed in Yeast.

Reticulocalbin-1/RCN1 Protein, Human, Recombinant (His)

Reticulocalbin-1/RCN1 Protein, Human, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-02030
Reticulocalbin-1/RCN1 Protein, Human, Recombinant (His) is expressed in Yeast.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 μg$8620 days20 days
10 μg$13820 days20 days
20 μg$23120 days20 days
50 μg$34820 days20 days
100 μg$48020 days20 days
200 μg$74320 days20 days
500 μg$1,33020 days20 days
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Reticulocalbin-1/RCN1 Protein, Human, Recombinant (His) is expressed in Yeast.
Species
Human
Expression System
P. pastoris (Yeast)
TagN-6xHis
Accession NumberQ15293
Synonyms
Reticulocalbin-1,RCN1,RCN
Amino Acid
PTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL
Construction
31-331 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight37.7 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
May regulate calcium-dependent activities in the endoplasmic reticulum lumen or post-ER compartment.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords