RCOM_0530710 Protein, Ricinus communis, Recombinant (His)

Name: RCOM_0530710 Protein, Ricinus communis, Recombinant (His)
Brand: TargetMol
SKU: TMPH-03410
Rating: 4.5 (1 reviews)

(Synonyms: Glycosyltransferase family 92 protein RCOM_0530710) Copy Product Info

Synonyms: Glycosyltransferase family 92 protein RCOM_0530710

Catalog No. TMPH-03410 Copy Product Info

RCOM_0530710 Protein, Ricinus communis, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 64.8 kDa and the accession number is B9SLR1.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$289	20 days	20 days
10 µg	$485	20 days	20 days
20 µg	$817	20 days	20 days
50 µg	$1,130	20 days	20 days
100 µg	$1,450	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	RCOM_0530710 Protein, Ricinus communis, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 64.8 kDa and the accession number is B9SLR1.
Species	Ricinus communis
Expression System	E. coli
Tag	N-10xHis
Accession Number	B9SLR1
Amino Acid	MKDRRRRETVSWNRFFWCTLLLVLSCVLFTASTFREKFQPEIVSAWRQPAMEATTTIMSTNSPAKPSISIRETVMLPDQVLIFVNYPQSSRLFTKEDFSCVYFSRNSTSLSETQLKKPPNQIDGTDVNNQIVRCPLNPRGFSVSLELKSGGGYINPGPTHRWDSLVYEAMIDRDNTTVVFVKGFNLRADRIYNASKFECVYGWDFRKTKFVLRSNVISIAQEIVRCQTPLSILNNQLKVNNAIKVSIRLKGKGTLHSIARPGVQLLTDPEPGLRGEKPHEMCICTMLRNQGRFLKEWVMYHSQIGVERWFIYDNNSEDDIDSVIESLIDAKFNISRHVWPWVKAQEAGFAHCALRARGLCEWVGFIDVDEFFHLPTGLNLQDAVKNQSNSGNNVAELRVSCHSFGPSGLKHVPAQGVTVGYTCRMMLPERHKSIVKPEALNSTLINVVHHFHLRDGFRYVNADKGILVINHYKYQVWEVFKEKFYRRVATYVVDWQNEQNVGSKDRAPGLGTRAVEPPDWSSRFCEVSDTGLRDRILQNFLDPLTDLLPWQI
Construction	1-552 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Glycosyltransferase family 92 protein RCOM_0530710
Research Background	N/A

Chemical Properties

Molecular Weight

64.8 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Recombinant Proteins

Related Tags: RCOM_0530710 Protein, Ricinus communis, Recombinant (His) chemical structure | RCOM_0530710 Protein, Ricinus communis, Recombinant (His) molecular weight