Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

RB1 Protein, Human, Recombinant (His)

TargetMol | SPR
Catalog No. TMPH-04565

RB1 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is P06400.

RB1 Protein, Human, Recombinant (His)

RB1 Protein, Human, Recombinant (His)

TargetMol | SPR
Catalog No. TMPH-04565
RB1 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is P06400.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 μg$116-In Stock
10 μg$189-In Stock
20 μg$317-In Stock
50 μg$44820 days20 days
100 μg$58820 days20 days
200 μg$91320 days20 days
500 μg$1,63020 days20 days
1 mg$2,55020 days20 days
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More
Select Batch

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
RB1 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is P06400.
Species
Human
Expression System
E. coli
TagC-6xHis
Accession NumberP06400
Synonyms
Retinoblastoma-associated protein,RB1,pRb (Rb),pp110,p110-RB1,p105-Rb
Amino Acid
LQYASTRPPTLSPIPHIPRSPYKFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQKLAEMTSTRTRMQKQKMNDSMD
Construction
769-921 aa
Protein Purity
> 85% as determined by SDS-PAGE.
RB1 Protein, Human, Recombinant (His)
Molecular Weight24.0 kDa (Predicted)
EndotoxinNot tested.
FormulationLyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 202 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords