Shopping Cart
Remove All
Your shopping cart is currently empty
Rabies virus (RABV) (strain ERA) Glycoprotein (His)
(Synonyms: Glycoprotein) Copy Product InfoSynonyms: Glycoprotein
Catalog No. TMPH-03222 Copy Product Info
Attaches the virus to host cellular receptor, inducing endocytosis of the virion. In the endosome, the acidic pH induces conformational changes in the glycoprotein trimer, which trigger fusion between virus and cell membrane. There is convincing in vitro evidence that the muscular form of the nicotinic acetylcholine receptor (nAChR), the neuronal cell adhesion molecule (NCAM), and the p75 neurotrophin receptor (p75NTR) bind glycoprotein and thereby facilitate rabies virus entry into cells. Rabies virus (RABV) (strain ERA) Glycoprotein (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 55.0 kDa and the accession number is P03524.
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 µg | $129 | 20 days | 20 days | |
| 10 µg | $216 | 20 days | 20 days | |
| 20 µg | $360 | 20 days | 20 days | |
| 50 µg | $543 | 20 days | 20 days | |
| 100 µg | $745 | 20 days | 20 days | |
| 200 µg | $1,070 | 20 days | 20 days | |
| 500 µg | $1,730 | 20 days | 20 days | |
| 1 mg | $2,530 | 20 days | 20 days |
For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)
Add to Cart
Add to Quotation
For research use only—not for human use. No sales to individuals. Use as intended only.
Resource Download
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Attaches the virus to host cellular receptor, inducing endocytosis of the virion. In the endosome, the acidic pH induces conformational changes in the glycoprotein trimer, which trigger fusion between virus and cell membrane. There is convincing in vitro evidence that the muscular form of the nicotinic acetylcholine receptor (nAChR), the neuronal cell adhesion molecule (NCAM), and the p75 neurotrophin receptor (p75NTR) bind glycoprotein and thereby facilitate rabies virus entry into cells. Rabies virus (RABV) (strain ERA) Glycoprotein (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 55.0 kDa and the accession number is P03524. |
| Species | RABV |
| Expression System | E. coli |
| Tag | N-6xHis |
| Accession Number | P03524 |
| Amino Acid | KFPIYTILDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLSGFSYMELKVGYILAIKMNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNWKMAGDPRYEESLHNPYPDYRWLRTVKTTKESLVIISPSVADLDPYDRSLHSRVFPSGKCSGVAVSSTYCSTNHDYTIWMPENPRLGMSCDIFTNSRGKRASKGSETCGFVDERGLYKSLKGACKLKLCGVLGLRLMDGTWVAMQTSNETKWCPPDQLVNLHDFRSDEIEHLVVEELVRKREECLDALESIMTTKSVSFRRLSHLRKLVPGFGKAYTIFNKTLMEADAHYKSVRTWNEILPSKGCLRVGGRCHPHVNGVFFNGIILGPDGNVLIPEMQSSLLQQHMELLESSVIPLVHPLADPSTVFKDGDEAEDFVEVHLPDVHNQVSGVDLGLPNWGKY |
| Construction | 20-459 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Synonyms | Glycoprotein |
| Research Background | Attaches the virus to host cellular receptor, inducing endocytosis of the virion. In the endosome, the acidic pH induces conformational changes in the glycoprotein trimer, which trigger fusion between virus and cell membrane. There is convincing in vitro evidence that the muscular form of the nicotinic acetylcholine receptor (nAChR), the neuronal cell adhesion molecule (NCAM), and the p75 neurotrophin receptor (p75NTR) bind glycoprotein and thereby facilitate rabies virus entry into cells. |
| Molecular Weight | 55.0 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
You can also refer to dose conversion for different animals. More Dose Conversion
Tech Support
Please see Recombinant Proteins
Keywords
Preview
Related Tags: Rabies virus (RABV) (strain ERA) Glycoprotein (His) chemical structure | Rabies virus (RABV) (strain ERA) Glycoprotein (His) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.