Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

PSMD14 Protein, Human, Recombinant (His & MBP)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-00849 Copy Product Info
PSMD14 Protein, Human, Recombinant (His & MBP) is expressed in Baculovirus insect cells with N-MBP and C-6xHis tag. The predicted molecular weight is 79.2 kDa and the accession number is O00487.

PSMD14 Protein, Human, Recombinant (His & MBP)

Catalog No. TMPH-00849
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

PSMD14 Protein, Human, Recombinant (His & MBP) is expressed in Baculovirus insect cells with N-MBP and C-6xHis tag. The predicted molecular weight is 79.2 kDa and the accession number is O00487.

PSMD14 Protein, Human, Recombinant (His & MBP)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$17620 days20 days
10 μg$29320 days20 days
20 μg$49120 days20 days
50 μg$92620 days20 days
100 μg$1,50020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
PSMD14 Protein, Human, Recombinant (His & MBP) is expressed in Baculovirus insect cells with N-MBP and C-6xHis tag. The predicted molecular weight is 79.2 kDa and the accession number is O00487.
Species
Human
Expression System
Baculovirus Insect Cells
TagN-MBP, C-6xHis
Accession NumberO00487
Synonyms
PSMD14,POH1,26S proteasome-associated PAD1 homolog 1,26S proteasome regulatory subunit RPN11,26S proteasome non-ATPase regulatory subunit 14
Amino Acid
MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSNLGHLNKPSIQALIHGLNRHYYSITINYRKNELEQKMLLNLHKKSWMEGLTLQDYSEHCKHNESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCLAAMLDTVVFK
Construction
1-310 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight79.2 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which could impair cellular functions, and by removing proteins whose functions are no longer required. Therefore, the proteasome participates in numerous cellular processes, including cell cycle progression, apoptosis, or DNA damage repair. The PSMD14 subunit is a metalloprotease that specifically cleaves 'Lys-63'-linked polyubiquitin chains within the complex. Plays a role in response to double-strand breaks (DSBs): acts as a regulator of non-homologous end joining (NHEJ) by cleaving 'Lys-63'-linked polyubiquitin, thereby promoting retention of JMJD2A/KDM4A on chromatin and restricting TP53BP1 accumulation. Also involved in homologous recombination repair by promoting RAD51 loading.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords