PSMD14 Protein, Human, Recombinant (His & MBP)

Name: PSMD14 Protein, Human, Recombinant (His & MBP)
Brand: TargetMol
SKU: TMPH-00849
Rating: 4.5 (1 reviews)

(Synonyms: PSMD14, POH1, 26S proteasome-associated PAD1 homolog 1, 26S proteasome regulatory subunit RPN11, 26S proteasome non-ATPase regulatory subunit 14) Copy Product Info

Synonyms: PSMD14, POH1, 26S proteasome-associated PAD1 homolog 1, 26S proteasome regulatory subunit RPN11, 26S proteasome non-ATPase regulatory subunit 14

Catalog No. TMPH-00849 Copy Product Info

PSMD14 Protein, Human, Recombinant (His & MBP) is expressed in Baculovirus insect cells with N-MBP and C-6xHis tag. The predicted molecular weight is 79.2 kDa and the accession number is O00487.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$176	20 days	20 days
10 µg	$293	20 days	20 days
20 µg	$491	20 days	20 days
50 µg	$926	20 days	20 days
100 µg	$1,500	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	PSMD14 Protein, Human, Recombinant (His & MBP) is expressed in Baculovirus insect cells with N-MBP and C-6xHis tag. The predicted molecular weight is 79.2 kDa and the accession number is O00487.
Species	Human
Expression System	Baculovirus Insect Cells
Tag	N-MBP, C-6xHis
Accession Number	O00487
Amino Acid	MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSNLGHLNKPSIQALIHGLNRHYYSITINYRKNELEQKMLLNLHKKSWMEGLTLQDYSEHCKHNESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCLAAMLDTVVFK
Construction	1-310 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	PSMD14, POH1, 26S proteasome-associated PAD1 homolog 1, 26S proteasome regulatory subunit RPN11, 26S proteasome non-ATPase regulatory subunit 14
Research Background	Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which could impair cellular functions, and by removing proteins whose functions are no longer required. Therefore, the proteasome participates in numerous cellular processes, including cell cycle progression, apoptosis, or DNA damage repair. The PSMD14 subunit is a metalloprotease that specifically cleaves 'Lys-63'-linked polyubiquitin chains within the complex. Plays a role in response to double-strand breaks (DSBs): acts as a regulator of non-homologous end joining (NHEJ) by cleaving 'Lys-63'-linked polyubiquitin, thereby promoting retention of JMJD2A/KDM4A on chromatin and restricting TP53BP1 accumulation. Also involved in homologous recombination repair by promoting RAD51 loading.

Chemical Properties

Molecular Weight

79.2 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.