Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

Promotilin Protein, Human, Recombinant (GST & His & Myc)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-01922

Promotilin Protein, Human, Recombinant (GST & His & Myc) is expressed in E. coli.

Promotilin Protein, Human, Recombinant (GST & His & Myc)

Promotilin Protein, Human, Recombinant (GST & His & Myc)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-01922
Promotilin Protein, Human, Recombinant (GST & His & Myc) is expressed in E. coli.
Pack SizePriceAvailabilityQuantity
5 μg$8920 days
10 μg$14320 days
20 μg$23720 days
50 μg$35820 days
100 μg$49020 days
200 μg$75520 days
500 μg$1,33020 days
1 mg$2,08020 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Promotilin Protein, Human, Recombinant (GST & His & Myc) is expressed in E. coli.
Species
Human
Expression System
E. coli
TagN-10xHis-GST, C-Myc
Accession NumberP12872
Synonyms
Promotilin,MLN
Amino Acid
FVPIFTYGELQRMQEKERNKGQKKSLSVWQRSGEEGPVDPAEPIREEENEMIKLTAPLEIGMRMNSRQLEKYPATLEGLLSEMLPQHAAK
Construction
26-115 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight45.5 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Plays an important role in the regulation of interdigestive gastrointestinal motility and indirectly causes rhythmic contraction of duodenal and colonic smooth muscle.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.