Shopping Cart
- Remove All
- Your shopping cart is currently empty
Porin MspA Protein, Mycobacterium smegmatis, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 25.4 kDa and the accession number is A0QR29.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
20 μg | $360 | 20 days | |
100 μg | $745 | 20 days | |
1 mg | $2,530 | 20 days |
Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
Description | Porin MspA Protein, Mycobacterium smegmatis, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 25.4 kDa and the accession number is A0QR29. |
Species | Mycobacterium smegmatis |
Expression System | E. coli |
Tag | N-10xHis |
Accession Number | A0QR29 |
Synonyms | Porin MspA,mspA |
Amino Acid | GLDNELSLVDGQDRTLTVQQWDTFLNGVFPLDRNRLTREWFHSGRAKYIVAGPGADEFEGTLELGYQIGFPWSLGVGINFSYTTPNILIDDGDITAPPFGLNSVITPNLFPGVSISADLGNGPGIQEVATFSVDVSGAEGGVAVSNAHGTVTGAAGGVLLRPFARLIASTGDSVTTYGEPWNMN |
Construction | 28-211 aa |
Protein Purity | > 85% as determined by SDS-PAGE. ![]() |
Molecular Weight | 25.4 kDa (predicted) |
Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
Formulation | 0.2 μm sterile filtered 20 mM Tris-HCl, 0.5 M NaCl, pH 8.0, 50% glycerol |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | The major porin in this organism, forms a water-filled channel which favors the permeation of cations, amino acids, iron Fe(3+) and less efficiently phosphate. Does not transport Fe-ExoMS, the predominant siderophore. Plays a role in transport of beta-lactamase and hydrophilic fluoroquinolone antibiotics such as norfloxacin as well as chloramphenicol. There are about 2400 porins in wild-type, 800 in an mspA deletion and 150 in a double mspA-mspC deletion. Different conductance values with maxima at 2.3 and 4.6 nanosiemens might be caused by a simultaneous reconstitution of MspA channels into the membrane or by the existence of different MspA conformations. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.