PMP2 Protein, Horse, Recombinant (His & SUMO)

Name: PMP2 Protein, Horse, Recombinant (His & SUMO)
Brand: TargetMol
SKU: TMPH-00831
Rating: 4.5 (1 reviews)

(Synonyms: PMP2, Myelin P2 protein) Copy Product Info

Synonyms: PMP2, Myelin P2 protein

Catalog No. TMPH-00831 Copy Product Info

May play a role in lipid transport protein in Schwann cells. May bind cholesterol. PMP2 Protein, Horse, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 30.4 kDa and the accession number is P0C6G6.

Pack Size	Price	USA Stock	Global Stock
5 µg	$129	20 days	20 days
10 µg	$216	20 days	20 days
20 µg	$360	20 days	20 days
50 µg	$543	20 days	20 days
100 µg	$745	20 days	20 days
200 µg	$1,070	20 days	20 days
500 µg	$1,730	20 days	20 days
1 mg	$2,530	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	May play a role in lipid transport protein in Schwann cells. May bind cholesterol. PMP2 Protein, Horse, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 30.4 kDa and the accession number is P0C6G6.
Species	Horse
Expression System	E. coli
Tag	N-6xHis-SUMO
Accession Number	P0C6G6
Amino Acid	SNKFLGTWKLTSSENFDEYMKALGVGLGTRSLGNLAGPTVIISKSGDVITIRTESGFKNTEISFKLGQEFEETTADNRKTKSTVTLAGGKLNQVQKWNGNETTIKRELVDGKMVVECSMASVVCTRIYEQV
Construction	2-132 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	PMP2, Myelin P2 protein
Research Background	May play a role in lipid transport protein in Schwann cells. May bind cholesterol.

Chemical Properties

Molecular Weight

30.4 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.