Shopping Cart
- Remove All
- Your shopping cart is currently empty
Gametocyte surface protein required for male/female gamete fusion. Also required for male gamete exflagellation and interaction with erythrocytes. PFS230 Protein, Plasmodium falciparum, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 15.9 kDa and the accession number is P68874.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 μg | $185 | 20 days | |
10 μg | $297 | 20 days | |
20 μg | $515 | In Stock | |
50 μg | $713 | 20 days | |
100 μg | $916 | 20 days | |
200 μg | $1,260 | 20 days | |
500 μg | $1,930 | 20 days | |
1 mg | $2,690 | 20 days |
Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
Description | Gametocyte surface protein required for male/female gamete fusion. Also required for male gamete exflagellation and interaction with erythrocytes. PFS230 Protein, Plasmodium falciparum, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 15.9 kDa and the accession number is P68874. |
Species | Plasmodium falciparum |
Expression System | E. coli |
Tag | Tag Free |
Accession Number | P68874 |
Synonyms | S230,PFS230,PF230,Gametocyte surface protein P230 |
Amino Acid | YKEIHGCDFTGKYSHLFTYSKKPLPNDDDICNVTIGNNTFSGFACLSHFELKPNNCFSSVYDYNEANKVKKLFDLSTKVELDHIKQNTSGYTLSYIIFNKESTKLKFSCTCSSNYSNYTIRITFDPNYIIPEPQSRA |
Construction | 2980-3116 aa |
Protein Purity | > 90% as determined by SDS-PAGE. ![]() |
Molecular Weight | 15.9 kDa (predicted) |
Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | Gametocyte surface protein required for male/female gamete fusion. Also required for male gamete exflagellation and interaction with erythrocytes. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.