Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Peptide YY-like Protein, Chicken, Recombinant (hFc)

Copy Product Info
TargetMol | SPR
Catalog No. TMPH-04756

Peptide YY-like Protein, Chicken, Recombinant (hFc) is expressed in Yeast. The accession number is P29203.

Peptide YY-like Protein, Chicken, Recombinant (hFc)

Peptide YY-like Protein, Chicken, Recombinant (hFc)

Copy Product Info
TargetMol | SPR
Catalog No. TMPH-04756
Peptide YY-like Protein, Chicken, Recombinant (hFc) is expressed in Yeast. The accession number is P29203.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 μg$13920 days20 days
10 μg$22920 days20 days
20 μg$38220 days20 days
50 μg$54720 days20 days
100 μg$72020 days20 days
200 μg$1,08020 days20 days
500 μg$1,93020 days20 days
1 mg$2,97020 days20 days
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Peptide YY-like Protein, Chicken, Recombinant (hFc) is expressed in Yeast. The accession number is P29203.
Species
Chicken
Expression System
P. pastoris (Yeast)
TagN-hFc
Accession NumberP29203
Synonyms
PYY,Peptide YY-like
Amino Acid
AYPPKPESPGDAASPEEIAQYFSALRHYINLVTRQRY
Construction
1-37 aa
Protein Purity
> 95% as determined by SDS-PAGE.
Molecular Weight30.5 kDa (Predicted)
EndotoxinNot tested.
FormulationLyophilized from PBS, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 393 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords