PDCD10 Protein, Human, Recombinant (His & SUMO)

Name: PDCD10 Protein, Human, Recombinant (His & SUMO)
Brand: TargetMol
SKU: TMPH-01913
Rating: 4.5 (1 reviews)

(Synonyms: TFAR15, TF-1 cell apoptosis-related protein 15, Programmed cell death protein 10, PDCD10, Cerebral cavernous malformations 3 protein, CCM3) Copy Product Info

Synonyms: TFAR15, TF-1 cell apoptosis-related protein 15, Programmed cell death protein 10, PDCD10, Cerebral cavernous malformations 3 protein, CCM3

Catalog No. TMPH-01913 Copy Product Info

PDCD10 Protein, Human, Recombinant (His & SUMO) is expressed in E. coli.

Pack Size	Price	USA Stock	Global Stock
5 µg	$75	20 days	20 days
10 µg	$119	20 days	20 days
20 µg	$198	20 days	20 days
50 µg	$297	20 days	20 days
100 µg	$427	20 days	20 days
200 µg	$658	20 days	20 days
500 µg	$1,170	20 days	20 days
1 mg	$1,830	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	PDCD10 Protein, Human, Recombinant (His & SUMO) is expressed in E. coli.
Species	Human
Expression System	E. coli
Tag	N-6xHis-SUMO
Accession Number	Q9BUL8
Amino Acid	MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA
Construction	1-212 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	TFAR15, TF-1 cell apoptosis-related protein 15, Programmed cell death protein 10, PDCD10, Cerebral cavernous malformations 3 protein, CCM3
Research Background	Promotes cell proliferation. Modulates apoptotic pathways. Increases mitogen-activated protein kinase activity and STK26 activity. Important for cell migration, and for normal structure and assembly of the Golgi complex. Important for KDR/VEGFR2 signaling. Increases the stability of KDR/VEGFR2 and prevents its breakdown. Required for normal cardiovascular development. Required for normal angiogenesis, vasculogenesis and hematopoiesis during embryonic development.

Chemical Properties

Molecular Weight

40.7 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.