Shopping Cart
Remove All
Your shopping cart is currently empty
Synonyms: ponB, Penicillin-binding protein 1B, PBP-1b, PBP1b, Murein polymerase, mrcB


| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. |
| Description | PBP1b Protein, E. coli, Recombinant (His) is expressed in E. coli. The accession number is P02919. |
| Species | E. coli |
| Expression System | E. coli |
| Tag | C-6xHis |
| Accession Number | P02919 |
| Amino Acid | SVAQDAAEKAAVEGIPALKKQRKLSDLETAIVVVDRFSGEVRAMVGGSEPQFAGYNRAMQARRSIGSLAKPATYLTALSQPKIYRLNTWIADAPIALRQPNGQVWSPQNDDRRYSESGRVMLVDALTRSMNVPTVNLGMALGLPAVTETWIKLGVPKDQLHPVPAMLLGALNLTPIEVAQAFQTIASGGNRAPLSALRSVIAEDGKVLYQSFPQAERAVPAQAAYLTLWTMQQVVQRGTGRQLGAKYPNLHLAGKTGTTNNNVDTWFAGIDGSTVTITWVGRDNNQPTKLYGA |
| Construction | 444-736 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. ![]() |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from PBS, 6% Trehalose, pH 7.4. |
| Reconstitution | Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Synonyms | ponB, Penicillin-binding protein 1B, PBP-1b, PBP1b, Murein polymerase, mrcB |
| Molecular Weight | 38.5 kDa (Predicted); 39 kDa (Reducing condition) |
| Relative Density. | no data available |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.