PBP1b Protein, E. coli, Recombinant (His)

Name: PBP1b Protein, E. coli, Recombinant (His)
Brand: TargetMol
SKU: TMPH-04832
Rating: 4.5 (1 reviews)

(Synonyms: ponB, Penicillin-binding protein 1B, PBP-1b, PBP1b, Murein polymerase, mrcB) Copy Product Info

Synonyms: ponB, Penicillin-binding protein 1B, PBP-1b, PBP1b, Murein polymerase, mrcB

Catalog No. TMPH-04832 Copy Product Info

PBP1b Protein, E. coli, Recombinant (His) is expressed in E. coli. The accession number is P02919.

Add to Quotation

Questions

Resource Download

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description	PBP1b Protein, E. coli, Recombinant (His) is expressed in E. coli. The accession number is P02919.
Species	E. coli
Expression System	E. coli
Tag	C-6xHis
Accession Number	P02919
Amino Acid	SVAQDAAEKAAVEGIPALKKQRKLSDLETAIVVVDRFSGEVRAMVGGSEPQFAGYNRAMQARRSIGSLAKPATYLTALSQPKIYRLNTWIADAPIALRQPNGQVWSPQNDDRRYSESGRVMLVDALTRSMNVPTVNLGMALGLPAVTETWIKLGVPKDQLHPVPAMLLGALNLTPIEVAQAFQTIASGGNRAPLSALRSVIAEDGKVLYQSFPQAERAVPAQAAYLTLWTMQQVVQRGTGRQLGAKYPNLHLAGKTGTTNNNVDTWFAGIDGSTVTITWVGRDNNQPTKLYGA
Construction	444-736 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from PBS, 6% Trehalose, pH 7.4.
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	ponB, Penicillin-binding protein 1B, PBP-1b, PBP1b, Murein polymerase, mrcB

Chemical Properties

Molecular Weight	38.5 kDa (Predicted); 39 kDa (Reducing condition)
Relative Density.	no data available

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.