Shopping Cart
Remove All
Your shopping cart is currently empty
In muscle, parvalbumin is thought to be involved in relaxation after contraction. It binds two calcium ions. Parvalbumin beta Protein, Gadus morhua subsp. callarias, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 16.1 kDa and the accession number is P02622.

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 μg | $129 | 20 days | 20 days | |
| 10 μg | $216 | 20 days | 20 days | |
| 20 μg | $360 | 20 days | 20 days | |
| 50 μg | $543 | 20 days | 20 days | |
| 100 μg | $745 | 20 days | 20 days | |
| 200 μg | $1,070 | 20 days | 20 days | |
| 500 μg | $1,730 | 20 days | 20 days | |
| 1 mg | $2,530 | 20 days | 20 days |
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | In muscle, parvalbumin is thought to be involved in relaxation after contraction. It binds two calcium ions. Parvalbumin beta Protein, Gadus morhua subsp. callarias, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 16.1 kDa and the accession number is P02622. |
| Species | Gadus callarias |
| Expression System | E. coli |
| Tag | N-6xHis |
| Accession Number | P02622 |
| Synonyms | Parvalbumin beta,Allergen M,Allergen Gad c I |
| Amino Acid | AFKGILSNADIKAAEAACFKEGSFDEDGFYAKVGLDAFSADELKKLFKIADEDKEGFIEEDELKLFLIAFAADLRALTDAETKAFLKAGDSDGDGKIGVDEFGALVDKWGAKG |
| Construction | 1-113 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Molecular Weight | 16.1 kDa (predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
| Research Background | In muscle, parvalbumin is thought to be involved in relaxation after contraction. It binds two calcium ions. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.