Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

P2RX7 Protein, Human, Recombinant (His)

TargetMol | SPR
Catalog No. TMPH-04592 Copy Product Info
P2RX7 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q99572.

P2RX7 Protein, Human, Recombinant (His)

Catalog No. TMPH-04592
Copy Product Info
TargetMol | SPR

P2RX7 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q99572.

P2RX7 Protein, Human, Recombinant (His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$11620 days20 days
10 μg$18920 days20 days
20 μg$31720 days20 days
50 μg$44820 days20 days
100 μg$58820 days20 days
200 μg$91320 days20 days
500 μg$1,63020 days20 days
1 mg$2,55020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
P2RX7 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q99572.
Species
Human
Expression System
E. coli
TagN-6xHis, C-6xHis
Accession NumberQ99572
Synonyms
Purinergic receptor,P2Z receptor,P2X7,P2X purinoceptor 7,P2RX7,ATP receptor
Amino Acid
SDKLYQRKEPVISSVHTKVKGIAEVKEEIVENGVKKLVHSVFDTADYTFPLQGNSFFVMTNFLKTEGQEQRLCPEYPTRRTLCSSDRGCKKGWMDPQSKGIQTGRCVVHEGNQKTCEVSAWCPIEAVEEAPRPALLNSAENFTVLIKNNIDFPGHNYTTRNILPGLNITCTFHKTQNPQCPIFRLGDIFRETGDNFSDVAIQGGIMGIEIYWDCNLDRWFHHCHPKYSFRRLDDKTTNVSLYPGYNFRYAKYYKENNVEKRTLIKVFGIRFDILVFGTGGKFDIIQLV
Construction
47-334 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight43.1 kDa (Predicted)
EndotoxinNot tested.
FormulationLyophilized from PBS, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 229 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.