Otoraplin Protein, Mouse, Recombinant (His)

Catalog No. TMPH-02819 Copy Product Info

Otoraplin Protein, Mouse, Recombinant (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 14.0 kDa and the accession number is Q9JIE3.

Otoraplin Protein, Mouse, Recombinant (His)

Catalog No. TMPH-02819

Copy Product Info

Otoraplin Protein, Mouse, Recombinant (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 14.0 kDa and the accession number is Q9JIE3.

Pack Size	Price	USA Stock	Global Stock
5 μg	$95	20 days	20 days
10 μg	$155	20 days	20 days
20 μg	$256	20 days	20 days
50 μg	$386	20 days	20 days
100 μg	$528	20 days	20 days
200 μg	$817	20 days	20 days
500 μg	$1,460	20 days	20 days

Add to Cart

Add to Quotation

For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Otoraplin Protein, Mouse, Recombinant (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 14.0 kDa and the accession number is Q9JIE3.
Species	Mouse
Expression System	P. pastoris (Yeast)
Tag	C-6xHis
Accession Number	Q9JIE3
Synonyms	Otoraplin,Otor,Mial,Melanoma inhibitory activity-like protein
Amino Acid	HGVFMDKLSSKKLCADEECVYTISLARAQEDYNAPDCRFIDVKKGQQIYVYSKLVTENGAGEFWAGSVYGDHQDEMGIVGYFPSNLVKEQRVYQEATKEIPTTDIDFFCE
Construction	19-128 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Molecular Weight	14.0 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.