Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

OmpC Protein, E. coli, Recombinant

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-00696

Forms pores that allow passive diffusion of small molecules across the outer membrane.; (Microbial infection) Supports colicin E5 entry in the absence of its major receptor OmpF.; (Microbial infection) A mixed OmpC-OmpF heterotrimer is the outer membrane receptor for toxin CdiA-EC536; polymorphisms in extracellular loops 4 and 5 of OmpC confer susceptibility to CdiA-EC536-mediated toxicity.

OmpC Protein, E. coli, Recombinant

OmpC Protein, E. coli, Recombinant

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-00696
Forms pores that allow passive diffusion of small molecules across the outer membrane.; (Microbial infection) Supports colicin E5 entry in the absence of its major receptor OmpF.; (Microbial infection) A mixed OmpC-OmpF heterotrimer is the outer membrane receptor for toxin CdiA-EC536; polymorphisms in extracellular loops 4 and 5 of OmpC confer susceptibility to CdiA-EC536-mediated toxicity.
Pack SizePriceAvailabilityQuantity
5 μg$18520 days
10 μg$29720 days
20 μg$51520 days
50 μg$71320 days
100 μg$91620 days
200 μg$1,22020 days
500 μg$1,80020 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Forms pores that allow passive diffusion of small molecules across the outer membrane.; (Microbial infection) Supports colicin E5 entry in the absence of its major receptor OmpF.; (Microbial infection) A mixed OmpC-OmpF heterotrimer is the outer membrane receptor for toxin CdiA-EC536; polymorphisms in extracellular loops 4 and 5 of OmpC confer susceptibility to CdiA-EC536-mediated toxicity.
Species
E. coli
Expression System
E. coli
TagTag Free
Accession NumberP06996
Synonyms
Porin OmpC,par,Outer membrane protein C,Outer membrane protein 1B,Outer membrane porin C,ompC,meoA
Amino Acid
AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF
Construction
22-367 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight38.3 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Forms pores that allow passive diffusion of small molecules across the outer membrane.; (Microbial infection) Supports colicin E5 entry in the absence of its major receptor OmpF.; (Microbial infection) A mixed OmpC-OmpF heterotrimer is the outer membrane receptor for toxin CdiA-EC536; polymorphisms in extracellular loops 4 and 5 of OmpC confer susceptibility to CdiA-EC536-mediated toxicity.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.