OM Protein, Rat, Recombinant (His)

Catalog No. TMPH-03344

Has some calmodulin-like activity with respect to enzyme activation and growth regulation. Binds two calcium ions. OM Protein, Rat, Recombinant (His) is expressed in yeast with N-10xHis tag. The predicted molecular weight is 14.5 kDa and the accession number is P02631.

OM Protein, Rat, Recombinant (His)

Catalog No. TMPH-03344

Pack Size	Price	Availability
5 μg	$143	20 days
10 μg	$238	20 days
20 μg	$397	20 days
50 μg	$597	20 days
100 μg	$845	20 days
200 μg	$1,230	20 days
500 μg	$1,980	20 days
1 mg	$2,970	20 days

Bulk & Custom

Add to Cart

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Has some calmodulin-like activity with respect to enzyme activation and growth regulation. Binds two calcium ions. OM Protein, Rat, Recombinant (His) is expressed in yeast with N-10xHis tag. The predicted molecular weight is 14.5 kDa and the accession number is P02631.
Species	Rat
Expression System	P. pastoris (Yeast)
Tag	N-10xHis
Accession Number	P02631
Synonyms	Parvalbumin beta,Oncomodulin,OM,Ocm
Amino Acid	SITDILSAEDIAAALQECQDPDTFEPQKFFQTSGLSKMSASQVKDIFRFIDNDQSGYLDGDELKYFLQKFQSDARELTESETKSLMDAADNDGDGKIGADEFQEMVHS
Construction	2-109 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Molecular Weight	14.5 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background	Has some calmodulin-like activity with respect to enzyme activation and growth regulation. Binds two calcium ions.