Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

OARD1 Protein, Human, Recombinant (His & Myc)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-01804

OARD1 Protein, Human, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 24.3 kDa and the accession number is Q9Y530.

OARD1 Protein, Human, Recombinant (His & Myc)

OARD1 Protein, Human, Recombinant (His & Myc)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-01804
OARD1 Protein, Human, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 24.3 kDa and the accession number is Q9Y530.
Pack SizePriceAvailabilityQuantity
5 μg$12920 days
10 μg$21620 days
20 μg$36020 days
50 μg$54320 days
100 μg$74520 days
200 μg$1,07020 days
500 μg$1,73020 days
1 mg$2,53020 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
OARD1 Protein, Human, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 24.3 kDa and the accession number is Q9Y530.
Species
Human
Expression System
E. coli
TagN-10xHis, C-Myc
Accession NumberQ9Y530
Synonyms
Terminal ADP-ribose protein glycohydrolase 1,TARG1,OARD1,O-acetyl-ADP-ribose deacetylase 1,C6orf130,ADP-ribose glycohydrolase OARD1,[Protein ADP-ribosylglutamate] hydrolase OARD1
Amino Acid
ASSLNEDPEGSRITYVKGDLFACPKTDSLAHCISEDCRMGAGIAVLFKKKFGGVQELLNQQKKSGEVAVLKRDGRYIYYLITKKRASHKPTYENLQKSLEAMKSHCLKNGVTDLSMPRIGCGLDRLQWENVSAMIEEVFEATDIKITVYTL
Construction
2-152 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight24.3 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
ADP-ribose glycohydrolase that hydrolyzes ADP-ribose and acts on different substrates, such as proteins ADP-ribosylated on glutamate and O-acetyl-ADP-D-ribose. Specifically acts as a glutamate mono-ADP-ribosylhydrolase by mediating the removal of mono-ADP-ribose attached to glutamate residues on proteins. Does not act on poly-ADP-ribosylated proteins: the poly-ADP-ribose chain of poly-ADP-ribosylated glutamate residues must by hydrolyzed into mono-ADP-ribosylated glutamate by PARG to become a substrate for OARD1. Deacetylates O-acetyl-ADP ribose, a signaling molecule generated by the deacetylation of acetylated lysine residues in histones and other proteins. Catalyzes the deacylation of O-acetyl-ADP-ribose, O-propionyl-ADP-ribose and O-butyryl-ADP-ribose, yielding ADP-ribose plus acetate, propionate and butyrate, respectively.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords