NUFIP1 Protein, Human, Recombinant (His)

Name: NUFIP1 Protein, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPH-03778
Rating: 4.5 (1 reviews)

Copy Product Info

Synonyms:

Catalog No. TMPH-03778 Copy Product Info

NUFIP1 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q9UHK0.

Product information is being updated, if you want to purchase, please click the bulk custom button.

Add to Quotation

Questions

Batch Information

Select Batch

Purity:85%

Appearance:Solid

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description	NUFIP1 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q9UHK0.
Expression System	E. coli
Tag	C-6xHis
Accession Number	Q9UHK0
Amino Acid	PVFHFFCDTCDRGFKNQEKYDKHMSEHTKCPELDCSFTAHEKIVQFHWRNMHAPGMKKIKLDTPEEIARWREERRKNYPTLANIERKKKLKLEKEKRGAVLTTTQYGKMKGMSRHSQMAKIRSPGKNHKWKNDNSRQRAVTGSGSHLCDLKLEGPPEANADPLGVLINSDSESDKEEKPQHSVIPKEVTPALCSLMSSYGSLSGSESEPEETPIKTEADVLAENQVLDSSAPKSPSQDVKATVRNFSEAKSENRKKSFEKTNPKRKKDYHNYQTLFEPRTHHPYLLEMLLAPDIRHERNVILQC
Construction	aa 170-473
Protein Purity	≥ 85% as determined by SDS-PAGE.
Endotoxin	Untreated
Formulation	Lyophilized from PBS, 6% Trehalose, pH 7.4.
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Chemical Properties

Molecular Weight	46 kDa (Reducing condition)
Relative Density.	no data available

Storage & Solubility Information

Storage

Store at low temperature Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months Shipping with blue ice/Shipping at ambient temperature.

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

NUFIP1Protein,Human,Recombinant(His)

Related Tags: NUFIP1 Protein, Human, Recombinant (His) chemical structure | NUFIP1 Protein, Human, Recombinant (His) molecular weight