Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

NUFIP1 Protein, Human, Recombinant (His)

TargetMol | SPR
Catalog No. TMPH-03778 Copy Product Info
NUFIP1 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q9UHK0.

NUFIP1 Protein, Human, Recombinant (His)

Catalog No. TMPH-03778
Copy Product Info
TargetMol | SPR

NUFIP1 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q9UHK0.

NUFIP1 Protein, Human, Recombinant (His)
Pack SizePriceUSA StockGlobal StockQuantity
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Select Batch

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description
NUFIP1 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q9UHK0.
Expression System
E. coli
TagC-6xHis
Accession NumberQ9UHK0
Amino Acid
PVFHFFCDTCDRGFKNQEKYDKHMSEHTKCPELDCSFTAHEKIVQFHWRNMHAPGMKKIKLDTPEEIARWREERRKNYPTLANIERKKKLKLEKEKRGAVLTTTQYGKMKGMSRHSQMAKIRSPGKNHKWKNDNSRQRAVTGSGSHLCDLKLEGPPEANADPLGVLINSDSESDKEEKPQHSVIPKEVTPALCSLMSSYGSLSGSESEPEETPIKTEADVLAENQVLDSSAPKSPSQDVKATVRNFSEAKSENRKKSFEKTNPKRKKDYHNYQTLFEPRTHHPYLLEMLLAPDIRHERNVILQC
Construction
aa 170-473
Protein Purity
≥ 85% as determined by SDS-PAGE.
NUFIP1 Protein, Human, Recombinant (His)
Molecular Weight46 kDa (Reducing condition)
EndotoxinUntreated
FormulationLyophilized from PBS, 6% Trehalose, pH 7.4.
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords