Shopping Cart
Remove All
Your shopping cart is currently empty
NUFIP1 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q9UHK0.

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. |
| Description | NUFIP1 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q9UHK0. |
| Expression System | E. coli |
| Tag | C-6xHis |
| Accession Number | Q9UHK0 |
| Amino Acid | PVFHFFCDTCDRGFKNQEKYDKHMSEHTKCPELDCSFTAHEKIVQFHWRNMHAPGMKKIKLDTPEEIARWREERRKNYPTLANIERKKKLKLEKEKRGAVLTTTQYGKMKGMSRHSQMAKIRSPGKNHKWKNDNSRQRAVTGSGSHLCDLKLEGPPEANADPLGVLINSDSESDKEEKPQHSVIPKEVTPALCSLMSSYGSLSGSESEPEETPIKTEADVLAENQVLDSSAPKSPSQDVKATVRNFSEAKSENRKKSFEKTNPKRKKDYHNYQTLFEPRTHHPYLLEMLLAPDIRHERNVILQC |
| Construction | aa 170-473 |
| Protein Purity | ≥ 85% as determined by SDS-PAGE. ![]() |
| Molecular Weight | 46 kDa (Reducing condition) |
| Endotoxin | Untreated |
| Formulation | Lyophilized from PBS, 6% Trehalose, pH 7.4. |
| Reconstitution | Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.