NUFIP1 Protein, Human, Recombinant (His)

Name: NUFIP1 Protein, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPH-03778
Rating: 4.5 (1 reviews)

Copy Product Info

Synonyms:

Catalog No. TMPH-03778 Copy Product Info

NUFIP1 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q9UHK0.

Add to Quotation

Questions

Batch Information

Select Batch

Purity:85%

Appearance:Solid

Color:White

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description	NUFIP1 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q9UHK0.
Expression System	E. coli
Tag	C-6xHis
Accession Number	Q9UHK0
Amino Acid	PVFHFFCDTCDRGFKNQEKYDKHMSEHTKCPELDCSFTAHEKIVQFHWRNMHAPGMKKIKLDTPEEIARWREERRKNYPTLANIERKKKLKLEKEKRGAVLTTTQYGKMKGMSRHSQMAKIRSPGKNHKWKNDNSRQRAVTGSGSHLCDLKLEGPPEANADPLGVLINSDSESDKEEKPQHSVIPKEVTPALCSLMSSYGSLSGSESEPEETPIKTEADVLAENQVLDSSAPKSPSQDVKATVRNFSEAKSENRKKSFEKTNPKRKKDYHNYQTLFEPRTHHPYLLEMLLAPDIRHERNVILQC
Construction	aa 170-473
Protein Purity	≥ 85% as determined by SDS-PAGE.
Endotoxin	Untreated
Formulation	Lyophilized from PBS, 6% Trehalose, pH 7.4.
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.

Chemical Properties

Molecular Weight	46 kDa (Reducing condition)
Relative Density.	no data available

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.