NR2F6 Protein, Human, Recombinant (His & Myc)

Name: NR2F6 Protein, Human, Recombinant (His & Myc)
Brand: TargetMol
SKU: TMPH-01794
Rating: 4.5 (1 reviews)

(Synonyms: V-erbA-related protein 2 (EAR-2), Nuclear receptor subfamily 2 group F member 6, NR2F6, ERBAL2, EAR2) Copy Product Info

Synonyms: V-erbA-related protein 2 (EAR-2), Nuclear receptor subfamily 2 group F member 6, NR2F6, ERBAL2, EAR2

Catalog No. TMPH-01794 Copy Product Info

NR2F6 Protein, Human, Recombinant (His & Myc) is expressed in HEK293 mammalian cells with N-6xHis-Myc tag. The predicted molecular weight is 47.0 kDa and the accession number is P10588.

Pack Size	Price	USA Stock	Global Stock
5 µg	$167	20 days	20 days
10 µg	$278	20 days	20 days
20 µg	$465	20 days	20 days
50 µg	$878	20 days	20 days
100 µg	$1,430	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	NR2F6 Protein, Human, Recombinant (His & Myc) is expressed in HEK293 mammalian cells with N-6xHis-Myc tag. The predicted molecular weight is 47.0 kDa and the accession number is P10588.
Species	Human
Expression System	HEK293 Cells
Tag	N-6xHis-Myc
Accession Number	P10588
Amino Acid	MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGVFTCEGCKSFFKRSIRRNLSYTCRSNRDCQIDQHHRNQCQYCRLKKCFRVGMRKEAVQRGRIPHSLPGAVAASSGSPPGSALAAVASGGDLFPGQPVSELIAQLLRAEPYPAAAGRFGAGGGAAGAVLGIDNVCELAARLLFSTVEWARHAPFFPELPVADQVALLRLSWSELFVLNAAQAALPLHTAPLLAAAGLHAAPMAAERAVAFMDQVRAFQEQVDKLGRLQVDSAEYGCLKAIALFTPDACGLSDPAHVESLQEKAQVALTEYVRAQYPSQPQRFGRLLLRLPALRAVPASLISQLFFMRLVGKTPIETLIRDMLLSGSTFNWPYGSGQ
Construction	1-404 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	V-erbA-related protein 2 (EAR-2), Nuclear receptor subfamily 2 group F member 6, NR2F6, ERBAL2, EAR2
Research Background	Transcription factor predominantly involved in transcriptional repression. Binds to promoter/enhancer response elements that contain the imperfect 5'-AGGTCA-3' direct or inverted repeats with various spacings which are also recognized by other nuclear hormone receptors. Involved in modulation of hormonal responses. Represses transcriptional activity of the lutropin-choriogonadotropic hormone receptor/LHCGR gene, the renin/REN gene and the oxytocin-neurophysin/OXT gene. Represses the triiodothyronine-dependent and -independent transcriptional activity of the thyroid hormone receptor gene in a cell type-specific manner. The corepressing function towards thyroid hormone receptor beta/THRB involves at least in part the inhibition of THRB binding to triiodothyronine response elements (TREs) by NR2F6. Inhibits NFATC transcription factor DNA binding and subsequently its transcriptional activity. Acts as transcriptional repressor of IL-17 expression in Th-17 differentiated CD4(+) T cells and may be involved in induction and/or maintenance of peripheral immunological tolerance and autoimmunity. Involved in development of forebrain circadian clock; is required early in the development of the locus coeruleus (LC).

Chemical Properties

Molecular Weight

47.0 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.