Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Newcastle disease virus (NDV) (strain Her/33) Hemagglutinin-neuraminidase Protein (Baculovirus, His)

TargetMol | SPR
Catalog No. TMPH-04455 Copy Product Info
Newcastle disease virus (NDV) (strain Her/33) Hemagglutinin-neuraminidase Protein (Baculovirus, His) is expressed in Baculovirus. The accession number is P35741.

Newcastle disease virus (NDV) (strain Her/33) Hemagglutinin-neuraminidase Protein (Baculovirus, His)

Catalog No. TMPH-04455
Copy Product Info
TargetMol | SPR

Newcastle disease virus (NDV) (strain Her/33) Hemagglutinin-neuraminidase Protein (Baculovirus, His) is expressed in Baculovirus. The accession number is P35741.

Newcastle disease virus (NDV) (strain Her/33) Hemagglutinin-neuraminidase Protein (Baculovirus, His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$19620 days20 days
10 μg$32620 days20 days
20 μg$54820 days20 days
50 μg$98220 days20 days
100 μg$1,53020 days20 days
200 μg$1,93020 days20 days
500 μg$2,66020 days20 days
1 mg$3,39020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Newcastle disease virus (NDV) (strain Her/33) Hemagglutinin-neuraminidase Protein (Baculovirus, His) is expressed in Baculovirus. The accession number is P35741.
Species
Newcastle disease virus
Expression System
Baculovirus Insect Cells
TagC-6xHis
Accession NumberP35741
Synonyms
HN,Hemagglutinin-neuraminidase
Amino Acid
NGAANNSGCGAPVHDPDYIGGIGKELIVDDASDVTSFYPSAFQEHLNFIPAPTTGSGCTRIPSFDISATHYCYTHNVILSGCRDHSHSHQYLALGVLRTSATGRVFFSTLRSINLDDNQNRKSCSVSATPLGCDMLCSKITETEEEDYSSVTPTSMVHGRLGFDGQYHEKDLDVITLFKDWVANYPGVGGGSFIDNRVWFPVYGGLKPNSPSDTVQEGRYVIYKRYNDTCPDEQDYQIRMAKSSYKPGRFGGKRVQQAILSIKVSTSLGEDPVLTIPPNTVTLMGAEGRVLTVGTSHFLYQRGSSYFSPALLYPMTVNNKTATLHSPYTFNAFTRPGSVPCQASARCPNSCVTGVYTDP
Construction
115-473 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight44.8 kDa (Predicted)
EndotoxinNot tested.
FormulationLyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 92 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.