NDK1 Protein, Arabidopsis thaliana, Recombinant (His & Myc)

Name: NDK1 Protein, Arabidopsis thaliana, Recombinant (His & Myc)
Brand: TargetMol
SKU: TMPH-00099
Rating: 4.5 (1 reviews)

(Synonyms: Nucleoside diphosphate kinase I (NDK I;NDP kinase I;NDPK I), Nucleoside diphosphate kinase 1, NDPK1, NDK1) Copy Product Info

Synonyms: Nucleoside diphosphate kinase I (NDK I;NDP kinase I;NDPK I), Nucleoside diphosphate kinase 1, NDPK1, NDK1

Catalog No. TMPH-00099 Copy Product Info

Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Plays a role in response to reactive oxygen species (ROS) stress. NDK1 Protein, Arabidopsis thaliana, Recombinant (His & Myc) is expressed in yeast with N-10xHis and C-Myc tag. The predicted molecular weight is 20.5 kDa and the accession number is P39207.

NDK1 Protein, Arabidopsis thaliana, Recombinant (His & Myc)

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 μg	$143	20 days	20 days
10 μg	$238	20 days	20 days
20 μg	$397	20 days	20 days
50 μg	$597	20 days	20 days
100 μg	$845	20 days	20 days
200 μg	$1,190	20 days	20 days
500 μg	$1,950	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity


Description	Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Plays a role in response to reactive oxygen species (ROS) stress. NDK1 Protein, Arabidopsis thaliana, Recombinant (His & Myc) is expressed in yeast with N-10xHis and C-Myc tag. The predicted molecular weight is 20.5 kDa and the accession number is P39207.
Species	Arabidopsis thaliana
Expression System	P. pastoris (Yeast)
Tag	N-10xHis, C-Myc
Accession Number	P39207
Amino Acid	MEQTFIMIKPDGVQRGLIGEVICRFEKKGFTLKGLKLISVERSFAEKHYEDLSSKSFFSGLVDYIVSGPVVAMIWEGKNVVLTGRKIIGATNPAASEPGTIRGDFAIDIGRNVIHGSDSVESARKEIALWFPDGPVNWQSSVHPWVYET
Construction	1-149 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	Nucleoside diphosphate kinase I (NDK I;NDP kinase I;NDPK I), Nucleoside diphosphate kinase 1, NDPK1, NDK1
Research Background

Chemical Properties

Molecular Weight

20.5 kDa (predicted)

Storage & Solubility Information

Storage

Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

NDPK 1NDKINDK INDK 1

Related Tags: NDK1 Protein, Arabidopsis thaliana, Recombinant (His & Myc) chemical structure | NDK1 Protein, Arabidopsis thaliana, Recombinant (His & Myc) molecular weight