NAGK Protein, Human, Recombinant (His & SUMO)

Name: NAGK Protein, Human, Recombinant (His & SUMO)
Brand: TargetMol
SKU: TMPH-04600
Rating: 4.5 (1 reviews)

(Synonyms: NAGK, N-acetylglucosamine kinase, N-acetyl-D-mannosamine kinase, N-acetyl-D-glucosamine kinase, Muramyl dipeptide kinase, GlcNAc kinase) Copy Product Info

Synonyms: NAGK, N-acetylglucosamine kinase, N-acetyl-D-mannosamine kinase, N-acetyl-D-glucosamine kinase, Muramyl dipeptide kinase, GlcNAc kinase

Catalog No. TMPH-04600 Copy Product Info

NAGK Protein, Human, Recombinant (His & SUMO) is expressed in E. coli. The accession number is Q9UJ70.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$87	20 days	20 days
10 µg	$139	20 days	20 days
20 µg	$232	20 days	20 days
50 µg	$329	20 days	20 days
100 µg	$435	20 days	20 days
200 µg	$673	20 days	20 days
500 µg	$1,180	20 days	20 days
1 mg	$1,870	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	NAGK Protein, Human, Recombinant (His & SUMO) is expressed in E. coli. The accession number is Q9UJ70.
Species	Human
Expression System	E. coli
Tag	N-6xHis-SUMO
Accession Number	Q9UJ70
Amino Acid	AAIYGGVEGGGTRSEVLLVSEDGKILAEADGLSTNHWLIGTDKCVERINEMVNRAKRKAGVDPLVPLRSLGLSLSGGDQEDAGRILIEELRDRFPYLSESYLITTDAAGSIATATPDGGVVLISGTGSNCRLINPDGSESGCGGWGHMMGDEGSAYWIAHQAVKIVFDSIDNLEAAPHDIGYVKQAMFHYFQVPDRLGILTHLYRDFDKCRFAGFCRKIAEGAQQGDPLSRYIFRKAGEMLGRHIVAVLPEIDPVLFQGKIGLPILCVGSVWKSWELLKEGFLLALTQGREIQAQNFFSSFTLMKLRHSSALGGASLGARHIGHLLPMDYSANAIAFYSYTFS
Construction	2-344 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	Not tested.
Formulation	Lyophilized from PBS, 6% Trehalose, pH 7.4
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	NAGK, N-acetylglucosamine kinase, N-acetyl-D-mannosamine kinase, N-acetyl-D-glucosamine kinase, Muramyl dipeptide kinase, GlcNAc kinase

Chemical Properties

Molecular Weight

53.2 kDa (Predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 237 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.