Shopping Cart
- Remove All
- Your shopping cart is currently empty
NAD-ME Protein, Human, Recombinant (His) is expressed in E. coli with C-6xHis. The accession number is P23368.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 μg | $147 | 7-10 days | |
10 μg | $246 | 7-10 days | |
20 μg | $416 | 7-10 days | |
50 μg | $853 | 7-10 days | |
100 μg | $1,460 | 7-10 days | |
200 μg | $1,980 | 7-10 days | |
500 μg | $3,300 | 7-10 days |
Biological Activity | Malic Enzyme activity was assayed spectrophotometrically at 340nm as described in Mandela and Sauer (1975). The standard reaction mixture contained 50 mM Tris-HCl, 3 mM MnCl2, 5 mM malate, 0.12 mM NADP+, 2.5 mM fumarate. Assay was performed in a Beckman spectrophotometer. The Km value is 1.5 ± 0.6 mM |
Description | NAD-ME Protein, Human, Recombinant (His) is expressed in E. coli with C-6xHis. The accession number is P23368. |
Species | Human |
Expression System | E. coli |
Tag | C-6xHis |
Accession Number | P23368 |
Synonyms | NAD-ME,NAD-dependent malic enzyme, mitochondrial,mitochondrial,ME2,Malic enzyme 2 |
Amino Acid | MLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRSEYDSLLPDVYEWPESASSPPVITE+HHHHHH |
Construction | 19-584 aa |
Protein Purity | >95% as determined by SDS-PAGE. |
Molecular Weight | 64.4 kDa (Predicted) |
Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
Formulation | Lyophilized from a 0.2 μm filtered PBS, pH 7.4. |
Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.