NAD-ME Protein, Human, Recombinant (His)

Name: NAD-ME Protein, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPH-04029
Rating: 4.5 (1 reviews)

(Synonyms: NAD-ME, NAD-dependent malic enzyme, mitochondrial, mitochondrial, ME2, Malic enzyme 2) Copy Product Info

Synonyms: NAD-ME, NAD-dependent malic enzyme, mitochondrial, mitochondrial, ME2, Malic enzyme 2

Catalog No. TMPH-04029 Copy Product Info

NAD-ME Protein, Human, Recombinant (His) is expressed in E. coli with C-6xHis. The accession number is P23368.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$147	7-10 days	7-10 days
10 µg	$246	7-10 days	7-10 days
20 µg	$416	7-10 days	7-10 days
50 µg	$853	7-10 days	7-10 days
100 µg	$1,460	7-10 days	7-10 days
200 µg	$1,980	7-10 days	7-10 days
500 µg	$3,300	7-10 days	7-10 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Malic Enzyme activity was assayed spectrophotometrically at 340nm as described in Mandela and Sauer (1975). The standard reaction mixture contained 50 mM Tris-HCl, 3 mM MnCl2, 5 mM malate, 0.12 mM NADP+, 2.5 mM fumarate. Assay was performed in a Beckman spectrophotometer. The Km value is 1.5 ± 0.6 mM
Description	NAD-ME Protein, Human, Recombinant (His) is expressed in E. coli with C-6xHis. The accession number is P23368.
Species	Human
Expression System	E. coli
Tag	C-6xHis
Accession Number	P23368
Amino Acid	MLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRSEYDSLLPDVYEWPESASSPPVITE+HHHHHH
Construction	19-584 aa
Protein Purity	>95% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from a 0.2 μm filtered PBS, pH 7.4.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	NAD-ME, NAD-dependent malic enzyme, mitochondrial, mitochondrial, ME2, Malic enzyme 2

Chemical Properties

Molecular Weight

64.4 kDa (Predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.