Myoglobin Protein, Pig, Recombinant (His)

Catalog No. TMPH-04447 Copy Product Info

Myoglobin Protein, Pig, Recombinant (His) is expressed in E. coli. The accession number is P02189.

Catalog No. TMPH-04447

Copy Product Info

Myoglobin Protein, Pig, Recombinant (His) is expressed in E. coli. The accession number is P02189.

Pack Size	Price	USA Stock	Global Stock
5 μg	$98	20 days	20 days
10 μg	$159	20 days	20 days
20 μg	$266	20 days	20 days
50 μg	$378	20 days	20 days
100 μg	$498	20 days	20 days
200 μg	$769	20 days	20 days
500 μg	$1,370	20 days	20 days
1 mg	$2,130	20 days	20 days

Add to Cart

Add to Quotation

In stock · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Resource Download

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Myoglobin Protein, Pig, Recombinant (His) is expressed in E. coli. The accession number is P02189.
Species	Pig
Expression System	E. coli
Tag	N-6xHis
Accession Number	P02189
Synonyms	Pseudoperoxidase MB,Nitrite reductase MB,Myoglobin,MB
Amino Acid	GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGNTVLTALGGILKKKGHHEAELTPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHPGDFGADAQGAMSKALELFRNDMAAKYKELGFQG
Construction	2-154 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Molecular Weight	21.0 kDa (Predicted)
Endotoxin	Not tested.
Formulation	Lyophilized from PBS, 6% Trehalose, pH 7.4
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 84 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

You can also refer to dose conversion for different animals. More

Please read the User Guide of Recombinant Proteins for more specific information.