Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

MYL9 Protein, Human, Recombinant (His)

Catalog No. TMPH-04026

MYL9 Protein, Human, Recombinant (His) is expressed in P. pastoris (Yeast) with C-10xHis. The accession number is P24844.

MYL9 Protein, Human, Recombinant (His)

MYL9 Protein, Human, Recombinant (His)

Catalog No. TMPH-04026
MYL9 Protein, Human, Recombinant (His) is expressed in P. pastoris (Yeast) with C-10xHis. The accession number is P24844.
Pack SizePriceAvailabilityQuantity
20 μg$39720 days
100 μg$76920 days
1 mg$2,76020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Human MYL9 at 2 μg/mL can bind Anti-MYL9 recombinant antibody (CSB-RA015318MA1HU), the EC50 is 4.628-6.430 ng/mL.
Description
MYL9 Protein, Human, Recombinant (His) is expressed in P. pastoris (Yeast) with C-10xHis. The accession number is P24844.
Species
Human
Expression System
P. pastoris (Yeast)
TagC-10xHis
Accession NumberP24844
Synonyms
MYRL2,Myosin RLC,Myosin regulatory light polypeptide 9,Myosin regulatory light chain MRLC1,Myosin regulatory light chain 9,Myosin regulatory light chain 2, smooth muscle isoform,MYL9,MRLC1,MLC-2C,MLC2,20 kDa myosin light chain (LC20)
Amino Acid
SSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD
Construction
2-172 aa
Protein Purity
>95% as determined by SDS-PAGE.
Molecular Weight21.7 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords