Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

MYL9 Protein, Human, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-04026 Copy Product Info
MYL9 Protein, Human, Recombinant (His) is expressed in P. pastoris (Yeast) with C-10xHis. The accession number is P24844.

MYL9 Protein, Human, Recombinant (His)

Catalog No. TMPH-04026
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

MYL9 Protein, Human, Recombinant (His) is expressed in P. pastoris (Yeast) with C-10xHis. The accession number is P24844.

MYL9 Protein, Human, Recombinant (His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$14320 days20 days
10 μg$23820 days20 days
20 μg$39720 days20 days
50 μg$57820 days20 days
100 μg$76920 days20 days
200 μg$1,12020 days20 days
500 μg$1,87020 days20 days
1 mg$2,76020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Human MYL9 at 2 μg/mL can bind Anti-MYL9 recombinant antibody (CSB-RA015318MA1HU), the EC50 is 4.628-6.430 ng/mL.
Description
MYL9 Protein, Human, Recombinant (His) is expressed in P. pastoris (Yeast) with C-10xHis. The accession number is P24844.
Species
Human
Expression System
P. pastoris (Yeast)
TagC-10xHis
Accession NumberP24844
Synonyms
MYRL2,Myosin RLC,Myosin regulatory light polypeptide 9,Myosin regulatory light chain MRLC1,Myosin regulatory light chain 9,Myosin regulatory light chain 2, smooth muscle isoform,MYL9,MRLC1,MLC-2C,MLC2,20 kDa myosin light chain (LC20)
Amino Acid
SSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD
Construction
2-172 aa
Protein Purity
>95% as determined by SDS-PAGE.
Molecular Weight21.7 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords