Shopping Cart
Remove All
Your shopping cart is currently empty
MYL9 Protein, Human, Recombinant (His) is expressed in P. pastoris (Yeast) with C-10xHis. The accession number is P24844.

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 μg | $143 | 20 days | 20 days | |
| 10 μg | $238 | 20 days | 20 days | |
| 20 μg | $397 | 20 days | 20 days | |
| 50 μg | $578 | 20 days | 20 days | |
| 100 μg | $769 | 20 days | 20 days | |
| 200 μg | $1,120 | 20 days | 20 days | |
| 500 μg | $1,870 | 20 days | 20 days | |
| 1 mg | $2,760 | 20 days | 20 days |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Human MYL9 at 2 μg/mL can bind Anti-MYL9 recombinant antibody (CSB-RA015318MA1HU), the EC50 is 4.628-6.430 ng/mL. |
| Description | MYL9 Protein, Human, Recombinant (His) is expressed in P. pastoris (Yeast) with C-10xHis. The accession number is P24844. |
| Species | Human |
| Expression System | P. pastoris (Yeast) |
| Tag | C-10xHis |
| Accession Number | P24844 |
| Synonyms | MYRL2,Myosin RLC,Myosin regulatory light polypeptide 9,Myosin regulatory light chain MRLC1,Myosin regulatory light chain 9,Myosin regulatory light chain 2, smooth muscle isoform,MYL9,MRLC1,MLC-2C,MLC2,20 kDa myosin light chain (LC20) |
| Amino Acid | SSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD |
| Construction | 2-172 aa |
| Protein Purity | >95% as determined by SDS-PAGE. |
| Molecular Weight | 21.7 kDa (Predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.