Shopping Cart
Remove All
Your shopping cart is currently empty
Synonyms: MYRL2, Myosin RLC, Myosin regulatory light polypeptide 9, Myosin regulatory light chain MRLC1, Myosin regulatory light chain 9, Myosin regulatory light chain 2, smooth muscle isoform, MYL9, MRLC1, MLC-2C, MLC2, 20 kDa myosin light chain (LC20)


| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 µg | $143 | 12 days | 12 days | |
| 10 µg | $238 | 12 days | 12 days | |
| 20 µg | $397 | 12 days | 12 days | |
| 50 µg | $578 | 12 days | 12 days | |
| 100 µg | $769 | 12 days | 12 days | |
| 200 µg | $1,120 | 12 days | 12 days | |
| 500 µg | $1,870 | 12 days | 12 days | |
| 1 mg | $2,760 | 12 days | 12 days |
| Bioactivity | Measured by its binding ability in a functional ELISA. Immobilized Human MYL9 at 2 μg/mL can bind Anti-MYL9 recombinant antibody (CSB-RA015318MA1HU), the EC50 is 4.628-6.430 ng/mL. |
| Description | MYL9 Protein, Human, Recombinant (His) is expressed in P. pastoris (Yeast) with C-10xHis. The accession number is P24844. |
| Species | Human |
| Expression System | P. pastoris (Yeast) |
| Tag | C-10xHis |
| Accession Number | P24844 |
| Amino Acid | SSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD |
| Construction | 2-172 aa |
| Protein Purity | >95% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Synonyms | MYRL2, Myosin RLC, Myosin regulatory light polypeptide 9, Myosin regulatory light chain MRLC1, Myosin regulatory light chain 9, Myosin regulatory light chain 2, smooth muscle isoform, MYL9, MRLC1, MLC-2C, MLC2, 20 kDa myosin light chain (LC20) |
| Molecular Weight | 21.7 kDa (Predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.