MT2A Protein, Human, Recombinant (His)

Catalog No. TMPH-01668 Copy Product Info

Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.

MT2A Protein, Human, Recombinant (His)

Catalog No. TMPH-01668

Copy Product Info

Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.

Pack Size	Price	USA Stock	Global Stock
5 μg	$86	20 days	20 days
10 μg	$138	20 days	20 days
20 μg	$231	20 days	20 days
50 μg	$348	20 days	20 days
100 μg	$480	20 days	20 days
200 μg	$733	20 days	20 days
500 μg	$1,290	20 days	20 days
1 mg	$1,980	20 days	20 days

Add to Cart

Add to Quotation

For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.
Species	Human
Expression System	P. pastoris (Yeast)
Tag	N-6xHis
Accession Number	P02795
Synonyms	MT2A,MT-2,MT2,Metallothionein-II (MT-II),Metallothionein-2A,Metallothionein-2,CES1
Amino Acid	MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSC
Construction	1-59 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Molecular Weight	7.9 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background	Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

MT-II MTII MT 2 Metallothionein2 CES 1